PDB entry 2id9

View 2id9 on RCSB PDB site
Description: 1.85 A Structure of T87I/Y106W Phosphono-CheY
Class: signaling protein
Keywords: alpha beta protein Flavodoxin-like topology Rossman fold, SIGNALING PROTEIN
Deposited on 2006-09-14, released 2007-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY
    Species: Escherichia coli [TaxId:562]
    Gene: cheY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AE67 (0-127)
      • engineered (55)
      • engineered (85)
      • engineered (104)
    Domains in SCOPe 2.07: d2id9a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2id9A (A:)
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfviscwnmp
nmdglellktiradgamsalpvlmviaeakkeniiaaaqagasgwvvkpftaatleekln
kifeklgm