PDB entry 2id4

View 2id4 on RCSB PDB site
Description: The 1.9 A structure of Kex2 in complex with an Ac-R-E-R-K-chloromethyl ketone inhibitor.
Class: hydrolase/hydrolase inhibitor
Keywords: kex2, kexin, furin, proprotein, prohormone, convertase, subtilisin like protease, serine protease, hydrolase-hydrolase inhibitor complex
Deposited on 2006-09-14, released 2007-05-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kexin
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: KEX2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2id4a1, d2id4a2
  • Chain 'B':
    Compound: Kexin
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: KEX2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2id4b1, d2id4b2
  • Chain 'C':
    Compound: Ac-RERK-CMK inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ID4 (Start-4)
  • Chain 'D':
    Compound: Ac-RERK-CMK inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2ID4 (Start-4)
  • Heterogens: NDG, CA, NA, MLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2id4A (A:)
    appmdssllpvkeaedklsindplferqwhlvnpsfpgsdinvldlwynnitgagvvaai
    vddgldyenedlkdnfcaegswdfndntnlpkprlsddyhgtrcageiaakkgnnfcgvg
    vgynakisgirilsgdittedeaasliygldvndiyscswgpaddgrhlqgpsdlvkkal
    vkgvtegrdskgaiyvfasgnggtrgdncnydgytnsiysitigaidhkdlhppysegcs
    avmavtyssgsgeyihssdingrcsnshggtsaaaplaagvytllleanpnltwrdvqyl
    silsavgleknadgdwrdsamgkkyshrygfgkidahkliemsktwenvnaqtwfylptl
    yvsqstnsteetlesvitisekslqdanfkriehvtvtvdidteirgtttvdlispagii
    snlgvvrprdvssegfkdwtfmsvahwgengvgdwkikvkttenghridfhswrlklfge
    sidssktetfvfgndkeeverqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2id4A (A:)
    lpvkeaedklsindplferqwhlvnpsfpgsdinvldlwynnitgagvvaaivddgldye
    nedlkdnfcaegswdfndntnlpkprlsddyhgtrcageiaakkgnnfcgvgvgynakis
    girilsgdittedeaasliygldvndiyscswgpaddgrhlqgpsdlvkkalvkgvtegr
    dskgaiyvfasgnggtrgdncnydgytnsiysitigaidhkdlhppysegcsavmavtys
    sgsgeyihssdingrcsnshggtsaaaplaagvytllleanpnltwrdvqylsilsavgl
    eknadgdwrdsamgkkyshrygfgkidahkliemsktwenvnaqtwfylptlyvsqstns
    teetlesvitisekslqdanfkriehvtvtvdidteirgtttvdlispagiisnlgvvrp
    rdvssegfkdwtfmsvahwgengvgdwkikvkttenghridfhswrlklfgesidsskte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2id4B (B:)
    appmdssllpvkeaedklsindplferqwhlvnpsfpgsdinvldlwynnitgagvvaai
    vddgldyenedlkdnfcaegswdfndntnlpkprlsddyhgtrcageiaakkgnnfcgvg
    vgynakisgirilsgdittedeaasliygldvndiyscswgpaddgrhlqgpsdlvkkal
    vkgvtegrdskgaiyvfasgnggtrgdncnydgytnsiysitigaidhkdlhppysegcs
    avmavtyssgsgeyihssdingrcsnshggtsaaaplaagvytllleanpnltwrdvqyl
    silsavgleknadgdwrdsamgkkyshrygfgkidahkliemsktwenvnaqtwfylptl
    yvsqstnsteetlesvitisekslqdanfkriehvtvtvdidteirgtttvdlispagii
    snlgvvrprdvssegfkdwtfmsvahwgengvgdwkikvkttenghridfhswrlklfge
    sidssktetfvfgndkeeverqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2id4B (B:)
    lpvkeaedklsindplferqwhlvnpsfpgsdinvldlwynnitgagvvaaivddgldye
    nedlkdnfcaegswdfndntnlpkprlsddyhgtrcageiaakkgnnfcgvgvgynakis
    girilsgdittedeaasliygldvndiyscswgpaddgrhlqgpsdlvkkalvkgvtegr
    dskgaiyvfasgnggtrgdncnydgytnsiysitigaidhkdlhppysegcsavmavtys
    sgsgeyihssdingrcsnshggtsaaaplaagvytllleanpnltwrdvqylsilsavgl
    eknadgdwrdsamgkkyshrygfgkidahkliemsktwenvnaqtwfylptlyvsqstns
    teetlesvitisekslqdanfkriehvtvtvdidteirgtttvdlispagiisnlgvvrp
    rdvssegfkdwtfmsvahwgengvgdwkikvkttenghridfhswrlklfgesidsskt
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.