PDB entry 2id3

View 2id3 on RCSB PDB site
Description: Crystal structure of transcriptional regulator SCO5951 from Streptomyces coelicolor A3(2)
Class: transcription
Keywords: transcriptional regulator, structural genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSCRIPTION
Deposited on 2006-09-14, released 2006-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative transcriptional regulator
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCO5951
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2id3a1, d2id3a2
  • Chain 'B':
    Compound: Putative transcriptional regulator
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCO5951
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2id3b1, d2id3b2
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2id3A (A:)
    mgsshhhhhhssgrenlyfqghmpdpaapgtlrpggrtarireavllaagdalaadgfda
    ldlgeiarragvgkttvyrrwgtpgglaadlladmaeqslpradtgaleedlranarlvv
    rtlddprqgrlfraliaaslcneqaaealhrfyavrvdewagcvrdavargevpdgtdph
    gvvaavsaplyyallntgrslteadadraaraastaaragvwvtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2id3A (A:)
    ggrtarireavllaagdalaadgfdaldlgeiarragvgkttvyrrwgtpgglaadllad
    maeqslpradtgaleedlranarlvvrtlddprqgrlfraliaaslcneqaaealhrfya
    vrvdewagcvrdavargevpdgtdphgvvaavsaplyyallntgrslteadadraaraas
    taaragvwvtg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2id3B (B:)
    mgsshhhhhhssgrenlyfqghmpdpaapgtlrpggrtarireavllaagdalaadgfda
    ldlgeiarragvgkttvyrrwgtpgglaadlladmaeqslpradtgaleedlranarlvv
    rtlddprqgrlfraliaaslcneqaaealhrfyavrvdewagcvrdavargevpdgtdph
    gvvaavsaplyyallntgrslteadadraaraastaaragvwvtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2id3B (B:)
    grtarireavllaagdalaadgfdaldlgeiarragvgkttvyrrwgtpgglaadlladm
    aeqslpradtgaleedlranarlvvrtlddprqgrlfraliaaslcneqaaealhrfyav
    rvdewagcvrdavargevpdgtdphgvvaavsaplyyallntgrslteadadraaraast
    aaragvwvtg