PDB entry 2id0

View 2id0 on RCSB PDB site
Description: Escherichia coli RNase II
Class: hydrolase
Keywords: RNase, exoribonuclease, ribonuclease, exonuclease, nuclease, hydrolyase, mRNA decay, RNR family
Deposited on 2006-09-13, released 2006-10-03
The last revision prior to the SCOP 1.75 freeze date was dated 2006-10-17, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.227
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exoribonuclease 2
    Species: Escherichia coli
    Gene: rnb
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30850 (Start-643)
      • modified residue (50)
      • modified residue (54)
      • modified residue (131)
      • modified residue (181)
      • modified residue (207)
      • modified residue (260)
      • modified residue (285)
      • modified residue (392)
      • modified residue (416)
      • modified residue (504)
      • modified residue (530)
      • modified residue (539)
      • modified residue (575)
      • modified residue (632)
    Domains in SCOP 1.75: d2id0a1, d2id0a2, d2id0a3, d2id0a4
  • Chain 'B':
    Compound: Exoribonuclease 2
    Species: Escherichia coli
    Gene: rnb
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30850 (Start-643)
      • modified residue (50)
      • modified residue (54)
      • modified residue (131)
      • modified residue (181)
      • modified residue (207)
      • modified residue (260)
      • modified residue (285)
      • modified residue (392)
      • modified residue (416)
      • modified residue (504)
      • modified residue (530)
      • modified residue (539)
      • modified residue (575)
      • modified residue (632)
    Domains in SCOP 1.75: d2id0b1, d2id0b2, d2id0b3, d2id0b4
  • Chain 'C':
    Compound: Exoribonuclease 2
    Species: Escherichia coli
    Gene: rnb
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30850 (Start-643)
      • modified residue (50)
      • modified residue (54)
      • modified residue (131)
      • modified residue (181)
      • modified residue (207)
      • modified residue (260)
      • modified residue (285)
      • modified residue (392)
      • modified residue (416)
      • modified residue (504)
      • modified residue (530)
      • modified residue (539)
      • modified residue (575)
      • modified residue (632)
    Domains in SCOP 1.75: d2id0c1, d2id0c2, d2id0c3, d2id0c4
  • Chain 'D':
    Compound: Exoribonuclease 2
    Species: Escherichia coli
    Gene: rnb
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30850 (Start-643)
      • modified residue (50)
      • modified residue (54)
      • modified residue (131)
      • modified residue (181)
      • modified residue (207)
      • modified residue (260)
      • modified residue (285)
      • modified residue (392)
      • modified residue (416)
      • modified residue (504)
      • modified residue (530)
      • modified residue (539)
      • modified residue (575)
      • modified residue (632)
    Domains in SCOP 1.75: d2id0d1, d2id0d2, d2id0d3, d2id0d4
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2id0A (A:)
    mfqdnpllaqlkqqlhsqtpraegvvkatekgfgflevdaqksyfipppqmkkvmhgdri
    iavihsekeresaepeelvepfltrfvgkvqgkndrlaivpdhpllkdaipcraarglnh
    efkegdwavaemrrhplkgdrsfyaeltqyitfgddhfvpwwvtlarhnlekeapdgvat
    emldeglvredltaldfvtidsastedmddalfakalpddklqlivaiadptawiaegsk
    ldkaakiraftnylpgfnipmlprelsddlcslranevrpvlacrmtlsadgtiednief
    faatieskaklvydqvsdwlentgdwqpeseaiaeqvrllaqicqrrgewrhnhalvfkd
    rpdyrfilgekgevldivaeprrianriveeamiaanicaarvlrdklgfgiynvhmgfd
    panadalaallkthglhvdaeevltldgfcklrreldaqptgfldsrirrfqsfaeiste
    pgphfglgleayatwtspirkygdminhrllkavikgetatrpqdeitvqmaerrrlnrm
    aerdvgdwlyarflkdkagtdtrfaaeivdisrggmrvrlvdngaiafipapflhavrde
    lvcsqengtvqikgetvykvtdvidvtiaevrmetrsiiarpva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2id0A (A:)
    npllaqlkqqlhsqtpraegvvkatekgfgflevdaqksyfipppqmkkvmhgdriiavi
    hsekeresaepeelvepfltrfvgkvqgkndrlaivpdhpllkdaipcraarglnhefke
    gdwavaemrrhplkgdrsfyaeltqyitfgddhfvpwwvtlarhnlekeapdgvatemld
    eglvredltaldfvtidsastedmddalfakalpddklqlivaiadptawiaegskldka
    akiraftnylpgfnipmlprelsddlcslranevrpvlacrmtlsadgtiednieffaat
    ieskaklvydqvsdwlentgdwqpeseaiaeqvrllaqicqrrgewrhnhalvfkdrpdy
    rfilgekgevldivaeprrianriveeamiaanicaarvlrdklgfgiynvhmgfdpana
    dalaallkthglhvdaeevltldgfcklrreldaqptgfldsrirrfqsfaeistepgph
    fglgleayatwtspirkygdminhrllkavikgrpqdeitvqmaerrrlnrmaerdvgdw
    lyarflkdkagtdtrfaaeivdisrggmrvrlvdngaiafipapflhavrdelvcsqeng
    tvqikgetvykvtdvidvtiaevrmetrsiiarpva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2id0B (B:)
    mfqdnpllaqlkqqlhsqtpraegvvkatekgfgflevdaqksyfipppqmkkvmhgdri
    iavihsekeresaepeelvepfltrfvgkvqgkndrlaivpdhpllkdaipcraarglnh
    efkegdwavaemrrhplkgdrsfyaeltqyitfgddhfvpwwvtlarhnlekeapdgvat
    emldeglvredltaldfvtidsastedmddalfakalpddklqlivaiadptawiaegsk
    ldkaakiraftnylpgfnipmlprelsddlcslranevrpvlacrmtlsadgtiednief
    faatieskaklvydqvsdwlentgdwqpeseaiaeqvrllaqicqrrgewrhnhalvfkd
    rpdyrfilgekgevldivaeprrianriveeamiaanicaarvlrdklgfgiynvhmgfd
    panadalaallkthglhvdaeevltldgfcklrreldaqptgfldsrirrfqsfaeiste
    pgphfglgleayatwtspirkygdminhrllkavikgetatrpqdeitvqmaerrrlnrm
    aerdvgdwlyarflkdkagtdtrfaaeivdisrggmrvrlvdngaiafipapflhavrde
    lvcsqengtvqikgetvykvtdvidvtiaevrmetrsiiarpva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2id0B (B:)
    npllaqlkqqlhsqtpraegvvkatekgfgflevdaqksyfipppqmkkvmhgdriiavi
    hsekeresaepeelvepfltrfvgkvqgkndrlaivpdhpllkdaipcraarglnhefke
    gdwavaemrrhplkgdrsfyaeltqyitfgddhfvpwwvtlarhnlekeapdgvatemld
    eglvredltaldfvtidsastedmddalfakalpddklqlivaiadptawiaegskldka
    akiraftnylpgfnipmlprelsddlcslranevrpvlacrmtlsadgtiednieffaat
    ieskaklvydqvsdwlentgdwqpeseaiaeqvrllaqicqrrgewrhnhalvfkdrpdy
    rfilgekgevldivaeprrianriveeamiaanicaarvlrdklgfgiynvhmgfdpana
    dalaallkthglhvdaeevltldgfcklrreldaqptgfldsrirrfqsfaeistepgph
    fglgleayatwtspirkygdminhrllkavikgrpqdeitvqmaerrrlnrmaerdvgdw
    lyarflkdkagtdtrfaaeivdisrggmrvrlvdngaiafipapflhavrdelvcsqeng
    tvqikgetvykvtdvidvtiaevrmetrsiiarpva
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2id0C (C:)
    mfqdnpllaqlkqqlhsqtpraegvvkatekgfgflevdaqksyfipppqmkkvmhgdri
    iavihsekeresaepeelvepfltrfvgkvqgkndrlaivpdhpllkdaipcraarglnh
    efkegdwavaemrrhplkgdrsfyaeltqyitfgddhfvpwwvtlarhnlekeapdgvat
    emldeglvredltaldfvtidsastedmddalfakalpddklqlivaiadptawiaegsk
    ldkaakiraftnylpgfnipmlprelsddlcslranevrpvlacrmtlsadgtiednief
    faatieskaklvydqvsdwlentgdwqpeseaiaeqvrllaqicqrrgewrhnhalvfkd
    rpdyrfilgekgevldivaeprrianriveeamiaanicaarvlrdklgfgiynvhmgfd
    panadalaallkthglhvdaeevltldgfcklrreldaqptgfldsrirrfqsfaeiste
    pgphfglgleayatwtspirkygdminhrllkavikgetatrpqdeitvqmaerrrlnrm
    aerdvgdwlyarflkdkagtdtrfaaeivdisrggmrvrlvdngaiafipapflhavrde
    lvcsqengtvqikgetvykvtdvidvtiaevrmetrsiiarpva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2id0C (C:)
    npllaqlkqqlhsqtpraegvvkatekgfgflevdaqksyfipppqmkkvmhgdriiavi
    hsekeresaepeelvepfltrfvgkvqgkndrlaivpdhpllkdaipcraarglnhefke
    gdwavaemrrhplkgdrsfyaeltqyitfgddhfvpwwvtlarhnlekeapdgvatemld
    eglvredltaldfvtidsastedmddalfakalpddklqlivaiadptawiaegskldka
    akiraftnylpgfnipmlprelsddlcslranevrpvlacrmtlsadgtiednieffaat
    ieskaklvydqvsdwlentgdwqpeseaiaeqvrllaqicqrrgewrhnhalvfkdrpdy
    rfilgekgevldivaeprrianriveeamiaanicaarvlrdklgfgiynvhmgfdpana
    dalaallkthglhvdaeevltldgfcklrreldaqptgfldsrirrfqsfaeistepgph
    fglgleayatwtspirkygdminhrllkavikgrpqdeitvqmaerrrlnrmaerdvgdw
    lyarflkdkagtdtrfaaeivdisrggmrvrlvdngaiafipapflhavrdelvcsqeng
    tvqikgetvykvtdvidvtiaevrmetrsiiarpva
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2id0D (D:)
    mfqdnpllaqlkqqlhsqtpraegvvkatekgfgflevdaqksyfipppqmkkvmhgdri
    iavihsekeresaepeelvepfltrfvgkvqgkndrlaivpdhpllkdaipcraarglnh
    efkegdwavaemrrhplkgdrsfyaeltqyitfgddhfvpwwvtlarhnlekeapdgvat
    emldeglvredltaldfvtidsastedmddalfakalpddklqlivaiadptawiaegsk
    ldkaakiraftnylpgfnipmlprelsddlcslranevrpvlacrmtlsadgtiednief
    faatieskaklvydqvsdwlentgdwqpeseaiaeqvrllaqicqrrgewrhnhalvfkd
    rpdyrfilgekgevldivaeprrianriveeamiaanicaarvlrdklgfgiynvhmgfd
    panadalaallkthglhvdaeevltldgfcklrreldaqptgfldsrirrfqsfaeiste
    pgphfglgleayatwtspirkygdminhrllkavikgetatrpqdeitvqmaerrrlnrm
    aerdvgdwlyarflkdkagtdtrfaaeivdisrggmrvrlvdngaiafipapflhavrde
    lvcsqengtvqikgetvykvtdvidvtiaevrmetrsiiarpva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2id0D (D:)
    npllaqlkqqlhsqtpraegvvkatekgfgflevdaqksyfipppqmkkvmhgdriiavi
    hsekeresaepeelvepfltrfvgkvqgkndrlaivpdhpllkdaipcraarglnhefke
    gdwavaemrrhplkgdrsfyaeltqyitfgddhfvpwwvtlarhnlekeapdgvatemld
    eglvredltaldfvtidsastedmddalfakalpddklqlivaiadptawiaegskldka
    akiraftnylpgfnipmlprelsddlcslranevrpvlacrmtlsadgtiednieffaat
    ieskaklvydqvsdwlentgdwqpeseaiaeqvrllaqicqrrgewrhnhalvfkdrpdy
    rfilgekgevldivaeprrianriveeamiaanicaarvlrdklgfgiynvhmgfdpana
    dalaallkthglhvdaeevltldgfcklrreldaqptgfldsrirrfqsfaeistepgph
    fglgleayatwtspirkygdminhrllkavikgrpqdeitvqmaerrrlnrmaerdvgdw
    lyarflkdkagtdtrfaaeivdisrggmrvrlvdngaiafipapflhavrdelvcsqeng
    tvqikgetvykvtdvidvtiaevrmetrsiiarpva