PDB entry 2icx

View 2icx on RCSB PDB site
Description: Crystal Structure of a Putative UDP-glucose Pyrophosphorylase from Arabidopsis Thaliana with Bound UTP
Class: transferase
Keywords: At3g03250, UTP, putative UDP-glucose pyrophosphorylase, Structural Genomics Functional Follow-up Study, Structural Genomics, Protein Structure Initiative, PSI, CESG, Center for Eukaryotic Structural Genomics
Deposited on 2006-09-13, released 2006-09-26
The last revision prior to the SCOP 1.75 freeze date was dated 2007-02-20, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.195
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable UTP-glucose-1-phosphate uridylyltransferase 2
    Species: Arabidopsis thaliana
    Gene: At3g03250, T17B22.6
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2icxa1, d2icxa2
  • Chain 'B':
    Compound: Probable UTP-glucose-1-phosphate uridylyltransferase 2
    Species: Arabidopsis thaliana
    Gene: At3g03250, T17B22.6
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2icxb1, d2icxb2
  • Heterogens: DMS, UTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2icxA (A:)
    saattenlpqlksavdgltemseseksgfislvsrylsgeaqhiewskiqtptdeivvpy
    ekmtpvsqdvaetknlldklvvlklngglgttmgctgpksvievrdgltfldliviqien
    lnnkygckvplvlmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskg
    ktdkegwyppghgdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnk
    neycmevtpktladvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvn
    lkaikklveadalkmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvk
    assdlllvqsdlytlvdgfvtrnkartnpsnpsielgpefkkvatflsrfksipsiveld
    slkvsgdvwfgssivlkgkvtvaaksgvkleipdravvenkningpedl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2icxA (A:)
    lpqlksavdgltemseseksgfislvsrylsgewskiqtptdeivvpyekmtpvsqdvae
    tknlldklvvlklngglgttmgctgpksvievrdgltfldliviqienlnnkygckvplv
    lmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskgktdkegwyppgh
    gdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnkneycmevtpktl
    adggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaikklveadalk
    meiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvkassdlllvqsdlyt
    lvdgfvtrnkartnpsnpsielgpefkkvatflsrfksipsiveldslkvsgdvwfgssi
    vlkgkvtvaaksgvkleipdravvenkningpedl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2icxB (B:)
    saattenlpqlksavdgltemseseksgfislvsrylsgeaqhiewskiqtptdeivvpy
    ekmtpvsqdvaetknlldklvvlklngglgttmgctgpksvievrdgltfldliviqien
    lnnkygckvplvlmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskg
    ktdkegwyppghgdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnk
    neycmevtpktladvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvn
    lkaikklveadalkmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvk
    assdlllvqsdlytlvdgfvtrnkartnpsnpsielgpefkkvatflsrfksipsiveld
    slkvsgdvwfgssivlkgkvtvaaksgvkleipdravvenkningpedl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2icxB (B:)
    lpqlksavdgltemseseksgfislvsrylsgqhiewskiqtptdeivvpyekmtpvsqd
    vaetknlldklvvlklngglgttmgctgpksvievrdgltfldliviqienlnnkygckv
    plvlmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskgktdkegwyp
    pghgdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnkneycmevtp
    ktadvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaikklvea
    dalkmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvkassdlllvqs
    dlytlvdgfvtrnkartnpsnpsielgpefkkvatflsrfksipsiveldslkvsgdvwf
    gssivlkgkvtvaaksgvkleipdravvenkningpedl