PDB entry 2ict

View 2ict on RCSB PDB site
Description: Crystal structure of the bacterial antitoxin HigA from Escherichia coli at pH 8.5. Northeast Structural Genomics TARGET ER390.
Class: DNA binding protein
Keywords: helix-turn-helix, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, DNA BINDING PROTEIN
Deposited on 2006-09-13, released 2006-09-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: antitoxin higa
  Species: Escherichia coli [TaxId:199310]
  Gene: higa
  Database cross-references and differences (RAF-indexed):
  • Uniprot P67699 (0-93)
  Domains in SCOPe 2.08: d2icta_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ictA (A:)
  mkmanhprpgdiiqesldelnvslrefarameiapstasrlltgkaaltpemaiklsvvi
  gsspqmwlnlqnawslaeaektvdvsrlrrlvtq