PDB entry 2icr

View 2icr on RCSB PDB site
Description: Red fluorescent protein zRFP574 from Zoanthus sp.
Class: fluorescent protein
Keywords: red fluorescent protein, ZRFP574, Zoanthus sp., chromophore structure, CYS-PHE link
Deposited on 2006-09-13, released 2007-10-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: 0.178
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Red fluorescent protein zoanRFP
    Species: Zoanthus sp. [TaxId:105402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T4U4 (11-238)
      • engineered (12)
      • chromophore (73)
    Domains in SCOPe 2.03: d2icra_
  • Chain 'B':
    Compound: Red fluorescent protein zoanRFP
    Species: Zoanthus sp. [TaxId:105402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T4U4 (11-238)
      • engineered (12)
      • chromophore (73)
    Domains in SCOPe 2.03: d2icrb_
  • Chain 'C':
    Compound: Red fluorescent protein zoanRFP
    Species: Zoanthus sp. [TaxId:105402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T4U4 (11-238)
      • expression tag (10)
      • engineered (12)
      • chromophore (73)
    Domains in SCOPe 2.03: d2icrc_
  • Chain 'D':
    Compound: Red fluorescent protein zoanRFP
    Species: Zoanthus sp. [TaxId:105402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T4U4 (11-238)
      • engineered (12)
      • chromophore (73)
    Domains in SCOPe 2.03: d2icrd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2icrA (A:)
    mrgshhhhhhgsahgltddmtmhfrmegcvdghkfviegngngnpfkgkqfinlcviegg
    plpfsedilsaafdygnrlfteypegivdyfknscpagytwhrsfrfedgavcicsadit
    vnvrenciyhestfygvnfpadgpvmkkmttnwepscekiipinsqkilkgdvsmylllk
    dggryrcqfdtiykaktepkempdwhfiqhklnredrsdaknqkwqliehaiasrsalp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2icrA (A:)
    sahgltddmtmhfrmegcvdghkfviegngngnpfkgkqfinlcvieggplpfsedilsa
    afdygnrlfteypegivdyfknscpagytwhrsfrfedgavcicsaditvnvrenciyhe
    stfygvnfpadgpvmkkmttnwepscekiipinsqkilkgdvsmylllkdggryrcqfdt
    iykaktepkempdwhfiqhklnredrsdaknqkwqliehaiasrsalp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2icrB (B:)
    mrgshhhhhhgsahgltddmtmhfrmegcvdghkfviegngngnpfkgkqfinlcviegg
    plpfsedilsaafdygnrlfteypegivdyfknscpagytwhrsfrfedgavcicsadit
    vnvrenciyhestfygvnfpadgpvmkkmttnwepscekiipinsqkilkgdvsmylllk
    dggryrcqfdtiykaktepkempdwhfiqhklnredrsdaknqkwqliehaiasrsalp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2icrB (B:)
    sahgltddmtmhfrmegcvdghkfviegngngnpfkgkqfinlcvieggplpfsedilsa
    afdygnrlfteypegivdyfknscpagytwhrsfrfedgavcicsaditvnvrenciyhe
    stfygvnfpadgpvmkkmttnwepscekiipinsqkilkgdvsmylllkdggryrcqfdt
    iykaktepkempdwhfiqhklnredrsdaknqkwqliehaiasrsalp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2icrC (C:)
    mrgshhhhhhgsahgltddmtmhfrmegcvdghkfviegngngnpfkgkqfinlcviegg
    plpfsedilsaafdygnrlfteypegivdyfknscpagytwhrsfrfedgavcicsadit
    vnvrenciyhestfygvnfpadgpvmkkmttnwepscekiipinsqkilkgdvsmylllk
    dggryrcqfdtiykaktepkempdwhfiqhklnredrsdaknqkwqliehaiasrsalp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2icrC (C:)
    gsahgltddmtmhfrmegcvdghkfviegngngnpfkgkqfinlcvieggplpfsedils
    aafdygnrlfteypegivdyfknscpagytwhrsfrfedgavcicsaditvnvrenciyh
    estfygvnfpadgpvmkkmttnwepscekiipinsqkilkgdvsmylllkdggryrcqfd
    tiykaktepkempdwhfiqhklnredrsdaknqkwqliehaiasrsalp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2icrD (D:)
    mrgshhhhhhgsahgltddmtmhfrmegcvdghkfviegngngnpfkgkqfinlcviegg
    plpfsedilsaafdygnrlfteypegivdyfknscpagytwhrsfrfedgavcicsadit
    vnvrenciyhestfygvnfpadgpvmkkmttnwepscekiipinsqkilkgdvsmylllk
    dggryrcqfdtiykaktepkempdwhfiqhklnredrsdaknqkwqliehaiasrsalp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2icrD (D:)
    sahgltddmtmhfrmegcvdghkfviegngngnpfkgkqfinlcvieggplpfsedilsa
    afdygnrlfteypegivdyfknscpagytwhrsfrfedgavcicsaditvnvrenciyhe
    stfygvnfpadgpvmkkmttnwepscekiipinsqkilkgdvsmylllkdggryrcqfdt
    iykaktepkempdwhfiqhklnredrsdaknqkwqliehaiasrsalp