PDB entry 2icp

View 2icp on RCSB PDB site
Description: Crystal structure of the bacterial antitoxin HigA from Escherichia coli at pH 4.0. Northeast Structural Genomics Consortium TARGET ER390.
Class: DNA binding protein
Keywords: helix-turn-helix, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2006-09-13, released 2006-09-26
The last revision prior to the SCOP 1.75 freeze date was dated 2006-09-26, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.184
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antitoxin higa
    Species: Escherichia coli
    Gene: higa
    Database cross-references and differences (RAF-indexed):
    • Uniprot P67699 (Start-93)
      • modified residue (30)
      • modified residue (51)
      • modified residue (65)
    Domains in SCOP 1.75: d2icpa1
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2icpA (A:)
    mkmanhprpgdiiqesldelnvslrefarameiapstasrlltgkaaltpemaiklsvvi
    gsspqmwlnlqnawslaeaektvdvsrlrrlvtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2icpA (A:)
    rpgdiiqesldelnvslrefarameiapstasrlltgkaaltpemaiklsvvigsspqmw
    lnlqnawslaeaektvdvsrlrrlvtq