PDB entry 2icp
View 2icp on RCSB PDB site
Description: Crystal structure of the bacterial antitoxin HigA from Escherichia coli at pH 4.0. Northeast Structural Genomics Consortium TARGET ER390.
Class: DNA binding protein
Keywords: helix-turn-helix, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, DNA BINDING PROTEIN
Deposited on
2006-09-13, released
2006-09-26
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-07-24, with a file datestamp of
2019-07-19.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.35
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: antitoxin higa
Species: Escherichia coli [TaxId:199310]
Gene: higa
Database cross-references and differences (RAF-indexed):
- Uniprot P67699 (Start-93)
- modified residue (30)
- modified residue (51)
- modified residue (65)
Domains in SCOPe 2.08: d2icpa1 - Heterogens: MG, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2icpA (A:)
mkmanhprpgdiiqesldelnvslrefarameiapstasrlltgkaaltpemaiklsvvi
gsspqmwlnlqnawslaeaektvdvsrlrrlvtq
Sequence, based on observed residues (ATOM records): (download)
>2icpA (A:)
rpgdiiqesldelnvslrefarameiapstasrlltgkaaltpemaiklsvvigsspqmw
lnlqnawslaeaektvdvsrlrrlvtq