PDB entry 2icg

View 2icg on RCSB PDB site
Description: Crystal structure of a protein of unknown function (NP_472245.1) from Listeria innocua at 1.65 A resolution
Class: Structural Genomics/Unknown function
Keywords: NP_472245.1, hypothetical protein, Structural Genomics, PSI-2, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG, Structural Genomics-Unknown function COMPLEX
Deposited on 2006-09-12, released 2006-09-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.2
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lin2918 protein
    Species: Listeria innocua [TaxId:1642]
    Gene: NP_472245.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q926X2 (1-End)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (96)
      • modified residue (98)
    Domains in SCOPe 2.01: d2icga1
  • Heterogens: CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2icgA (A:)
gmassfleevdrlitlsgitfhasgtgtpelikiyqdalgnefpetyklflekygtltfn
gvsfygiskrglsaasipdvkfateqartfgdinkemimiknsgygsifsidtsiigseg
epvivetnlsfkdntekkvvansfgeflleeielsltdlg

    Sequence, based on observed residues (ATOM records): (download) 
    >2icgA (A:)
gmassfleevdrlitlsgitfhasgtgtpelikiyqdalgnefpetyklflekygtltfn
gvsfygiskrglsaasipdvkfateqartfgdinkemimiknsgygsifsidtsiigseg
epvivetnlsfkdntekkvvansfgeflleeielsltdl