PDB entry 2ibz

View 2ibz on RCSB PDB site
Description: Yeast Cytochrome BC1 Complex with Stigmatellin
Class: oxidoreductase
Keywords: multisubunit membrane protein complex, OXIDOREDUCTASE
Deposited on 2006-09-12, released 2007-03-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquinol-cytochrome-c reductase complex core protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07256 (0-430)
      • conflict (126)
    Domains in SCOPe 2.05: d2ibza1, d2ibza2
  • Chain 'B':
    Compound: Ubiquinol-cytochrome-c reductase complex core protein 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ibzb1, d2ibzb2
  • Chain 'C':
    Compound: cytochrome b
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00163 (0-384)
      • conflict (121)
    Domains in SCOPe 2.05: d2ibzc1, d2ibzc2
  • Chain 'D':
    Compound: Cytochrome c1, heme protein, mitochondrial precursor
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ibzd1, d2ibzd2
  • Chain 'E':
    Compound: Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ibze1, d2ibze2
  • Chain 'F':
    Compound: Ubiquinol-cytochrome c reductase complex 14 kDa protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ibzf_
  • Chain 'G':
    Compound: ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ibzg_
  • Chain 'H':
    Compound: Ubiquinol-cytochrome c reductase complex 17 kDa protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ibzh_
  • Chain 'I':
    Compound: Ubiquinol-cytochrome c reductase complex 7.3 kDa protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ibzi_
  • Chain 'X':
    Compound: Variable Heavy chain of antibody fragment
    Species: Mus musculus [TaxId:10090]
    Gene: variable domain antibody heavy chain
    Database cross-references and differences (RAF-indexed):
    • PDB 2IBZ (0-126)
    Domains in SCOPe 2.05: d2ibzx_
  • Chain 'Y':
    Compound: Variable Light chain of antibody fragment
    Species: Mus musculus [TaxId:10090]
    Gene: variable domain antibody light chain
    Database cross-references and differences (RAF-indexed):
    • PDB 2IBZ (0-106)
    Domains in SCOPe 2.05: d2ibzy_
  • Heterogens: HEM, FES, UQ6, SMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ibzA (A:)
    aevtqlsngivvatehnpsahtasvgvvfgsgaanenpynngvsnlwkniflskensava
    akeglalssnisrdfqsyivsslpgstdksldflnqsfiqqkanllsssnfeatkksvlk
    qvqdfedndhpnrvlehlhstafqntplslptrgtleslenlvvadlesfannhflnsna
    vvvgtgnikhedlvnsiesknlslqtgtkpvlkkkaaflgsevrlrddtlpkawislave
    gepvnspnyfvaklaaqifgsynafepasrlqgiklldniqeyqlcdnfnhfslsykdsg
    lwgfstatrnvtmiddlihftlkqwnrltisvtdteveraksllklqlgqlyesgnpvnd
    anllgaevlikgsklslgeafkkidaitvkdvkawagkrlwdqdiaiagtgqieglldym
    rirsdmsmmrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ibzB (B:)
    ltvsardaptkistlavkvhggsryatkdgvahllnrfnfqntntrsalklvresellgg
    tfkstldreyitlkatflkddlpyyvnaladvlyktafkpheltesvlpaarydyavaeq
    cpvksaedqlyaitfrkglgnpllydgvervslqdikdfadkvytkenlevsgenvvead
    lkrfvdesllstlpagkslvsksepkfflgeenrvrfigdsvaaigipvnkaslaqyevl
    anyltsalselsglissakldkftdgglftlfvrdqdsavvssnikkivadlkkgkdlsp
    ainytklknavqnesvsspielnfdavkdfklgkfnyvavgdvsnlpyldel
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ibzC (C:)
    mafrksnvylslvnsyiidspqpssinywwnmgsllglclviqivtgifmamhyssniel
    afssvehimrdvhngyilrylhangasfffmvmfmhmakglyygsyrsprvtlwnvgvii
    ftltiataflgyccvygqmshwgatvitnlfsaipfvgndivswlwggfsvsnptiqrff
    alhylvpfiiaamvimhlmalhihgssnplgitgnldripmhsyfifkdlvtvflfmlil
    alfvfyspntlghpdnyipgnplvtpasivpewyllpfyailrsipdkllgvitmfaail
    vllvlpftdrsvvrgntfkvlskffffifvfnfvllgqigachvevpyvlmgqiatfiyf
    ayfliivpvistienvlfyigrvnk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ibzD (D:)
    mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht
    neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv
    karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp
    attsqmakdvttflnwcaepehderkrlglktviilsslyllsiwvkkfkwagiktrkfv
    fnppkprk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ibzD (D:)
    mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht
    neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv
    karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp
    attsqmakdvttflnwcaepehderkrlglktviilsslyllsiwvkkfkwagiktrkfv
    fnppk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ibzE (E:)
    kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtatadvla
    makvevnlaaiplgknvvvkwqgkpvfirhrtpheiqeansvdmsalkdpqtdadrvkdp
    qwlimlgicthlgcvpigeagdfggwfcpchgshydisgrirkgpaplnleipayefdgd
    kvivg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ibzF (F:)
    mpqsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtal
    rrlpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdel
    dnievsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ibzF (F:)
    qsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalrr
    lpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeldn
    ievsk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2ibzG (G:)
    mgppsgktymgwwghmggpkqkgitsyavspyaqkplqgifhnavfnsfrrfksqflyvl
    ipagiywywwkngneyneflyskagreelervnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ibzG (G:)
    gppsgktymgwwghmggpkqkgitsyavspyaqkplqgifhnavfnsfrrfksqflyvli
    pagiywywwkngneyneflyskagreelervnv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ibzH (H:)
    vtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehkedcveeffhlqhy
    ldtataprlfdklk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2ibzI (I:)
    msfsslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaagd
    gdddde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ibzI (I:)
    sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ibzX (X:)
    evklqesgaglvqpsqslsltcsvtgysitsgyywnwirlfpgnklewvgyisnvgdnny
    npslkdrlsitrdtsknqfflklnsvttedtatyycarseyysvtgyamdywgqgttvtv
    ssawrhp
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ibzY (Y:)
    dieltqtpvslaaslgdrvtiscrasqdinnflnwyqqkpdgtiklliyytsrlhagvps
    rfsgsgsgtdysltisnlepediatyfcqhhikfpwtfgagtkleik