PDB entry 2ibx

View 2ibx on RCSB PDB site
Description: Influenza virus (VN1194) H5 HA
Class: viral protein
Keywords: Influenza, Haemagglutinin, H5N1, VIRAL PROTEIN
Deposited on 2006-09-12, released 2006-11-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.244
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ibxa1
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ibxb1
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ibxc_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ibxd_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ibxe_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ibxf_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ibxA (A:)
    mekivllfaivslvksdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdl
    dgvkplilrdcsvagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhl
    lsrinhfekiqiipksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsy
    nntnqedllvlwgihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsg
    rmeffwtilkpndainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmga
    inssmpfhnihpltigecpkyvksnrlvlatglrnspqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ibxA (A:)
    dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
    llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
    swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
    pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
    fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
    ecpkyvksnrlvlatglrnsp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ibxB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydyp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ibxC (C:)
    mekivllfaivslvksdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdl
    dgvkplilrdcsvagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhl
    lsrinhfekiqiipksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsy
    nntnqedllvlwgihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsg
    rmeffwtilkpndainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmga
    inssmpfhnihpltigecpkyvksnrlvlatglrnspqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ibxC (C:)
    dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
    llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
    swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
    pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
    fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
    ecpkyvksnrlvlatglrnsp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ibxD (D:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydyp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ibxE (E:)
    mekivllfaivslvksdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdl
    dgvkplilrdcsvagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhl
    lsrinhfekiqiipksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsy
    nntnqedllvlwgihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsg
    rmeffwtilkpndainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmga
    inssmpfhnihpltigecpkyvksnrlvlatglrnspqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ibxE (E:)
    dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
    llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
    swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
    pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
    fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
    ecpkyvksnrlvlatglrnsp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ibxF (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydyp