PDB entry 2ibn

View 2ibn on RCSB PDB site
Description: Crystal structure of Human myo-Inositol Oxygenase (MIOX)
Class: oxidoreductase
Keywords: reductase, inositol, diiron, Structural Genomics, Structural Genomics Consortium, SGC, OXIDOREDUCTASE
Deposited on 2006-09-11, released 2006-10-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2008-06-17, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.208
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inositol oxygenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGB7 (2-249)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d2ibna1, d2ibna2
  • Chain 'B':
    Compound: Inositol oxygenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGB7 (2-249)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d2ibnb2, d2ibnb3
  • Heterogens: FE, SO4, I1N, CYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ibnA (A:)
    smdrvfttyklmhthqtvdfvrskhaqfggfsykkmtvmeavdlldglvdesdpdvdfpn
    sfhafqtaegirkahpdkdwfhlvgllhdlgkvlalfgepqwavvgdtfpvgcrpqasvv
    fcdstfqdnpdlqdprystelgmyqphcgldrvlmswghdeymyqvmkfnkfslppeafy
    mirfhsfypwhtgrdyqqlcsqqdlamlpwvrefnkfdlytkcpdlpdvdklrpyyqgli
    dkycpgilsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ibnA (A:)
    smdrvfttyklmhthqtvdfvrskhaqfggfsykkmtvmeavdlldglvdesddfpnsfh
    afqtaegirkahpdkdwfhlvgllhdlgkvlalfgepqwavvgdtfpvgcrpqasvvfcd
    stfqdnpdlqdprystelgmyqphcgldrvlmswghdeymyqvmkfnkfslppeafymir
    fhsfypwhtgrdyqqlcsqqdlamlpwvrefnkfdllpdvdklrpyyqglidkycpgils
    w
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ibnB (B:)
    smdrvfttyklmhthqtvdfvrskhaqfggfsykkmtvmeavdlldglvdesdpdvdfpn
    sfhafqtaegirkahpdkdwfhlvgllhdlgkvlalfgepqwavvgdtfpvgcrpqasvv
    fcdstfqdnpdlqdprystelgmyqphcgldrvlmswghdeymyqvmkfnkfslppeafy
    mirfhsfypwhtgrdyqqlcsqqdlamlpwvrefnkfdlytkcpdlpdvdklrpyyqgli
    dkycpgilsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ibnB (B:)
    smdrvfttyklmhthqtvdfvrskhaqfggfsykkmtvmeavdlldglvdespnsfhafq
    taegirkahpdkdwfhlvgllhdlgkvlalfgepqwavvgdtfpvgcrpqasvvfcdstf
    qdnpdlqdprystelgmyqphcgldrvlmswghdeymyqvmkfnkfslppeafymirfhs
    fypwhtgrdyqqlcsqqdlamlpwvrefnkfdlvdklrpyyqglidkycpgilsw