PDB entry 2iay

View 2iay on RCSB PDB site
Description: Crystal structure of a duf1831 family protein (lp2179) from lactobacillus plantarum at 1.20 A resolution
Class: translation
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, translation
Deposited on 2006-09-08, released 2006-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Lactobacillus plantarum [TaxId:1590]
    Gene: NP_785678.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88V95 (1-113)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (28)
      • modified residue (60)
      • modified residue (71)
    Domains in SCOPe 2.07: d2iaya1, d2iaya2
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iayA (A:)
    gmaytttvkldgdtktytlsptvkkytlmdlgfvkgrsgafsfersldptspyqaafklk
    mtvnadltgfkmttvtgngvqranifkndahpeaveqlryilanfierdilttd