PDB entry 2iay

View 2iay on RCSB PDB site
Description: Crystal structure of a protein with unknown function from Lactobacillus plantarum at 1.20 A resolution
Class: Structural Genomics/Unknown function
Keywords: NP_785678.1, hypothetical protein, Structural Genomics, PSI-2, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG
Deposited on 2006-09-08, released 2006-10-10
The last revision prior to the SCOP 1.75 freeze date was dated 2006-10-10, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.121
AEROSPACI score: 0.99 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein
  Species: Lactobacillus plantarum
  Gene: NP_785678.1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q88V95 (1-113)
    • leader sequence (0)
    • modified residue (1)
    • modified residue (28)
    • modified residue (60)
    • modified residue (71)
  Domains in SCOP 1.75: d2iaya1
• Heterogens: CL, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2iayA (A:)
  gmaytttvkldgdtktytlsptvkkytlmdlgfvkgrsgafsfersldptspyqaafklk
  mtvnadltgfkmttvtgngvqranifkndahpeaveqlryilanfierdilttd