PDB entry 2ial

View 2ial on RCSB PDB site
Description: Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR
Class: immune system
Keywords: X-ray crystallography, major histocompatibility complex, T cell receptor, T cell stimulation, melanoma, tumor antigen, IMMUNE SYSTEM
Deposited on 2006-09-08, released 2007-04-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.21
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD4+ T cell receptor E8 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2iala1, d2iala2
  • Chain 'B':
    Compound: CD4+ T cell receptor E8 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ialb1, d2ialb2
  • Chain 'C':
    Compound: CD4+ T cell receptor E8 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ialc1, d2ialc2
  • Chain 'D':
    Compound: CD4+ T cell receptor E8 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2iald1, d2iald2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ialA (A:)
    iqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrlsa
    ttvaterysllyisssqttdsgvyfcaaliqgaqklvfgqgtrltinpniqnpdpavyql
    rdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfa
    canafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ialA (A:)
    iqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrlsa
    ttvaterysllyisssqttdsgvyfcaaliqgaqklvfgqgtrltinpniqnpdpavyql
    rdskdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfaca
    nafnnsiipedtffps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ialB (B:)
    nagvtqtpkfrilkigqsmtlqctqdmnhnymywyrqdpgmglkliyysvgagitdkgev
    pngynvsrsttedfplrlelaapsqtsvyfcastyhgtgyfgegswltvvedlnkvfppe
    vavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqplkeqpaln
    dsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgrad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ialB (B:)
    agvtqtpkfrilkigqsmtlqctqdmnhnymywyrqdpgmglkliyysvgagitdkgevp
    ngynvsrsttedfplrlelaapsqtsvyfcastyhgtgyfgegswltvvedlnkvfppev
    avfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqplkeqpalnd
    sryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgrad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ialC (C:)
    iqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrlsa
    ttvaterysllyisssqttdsgvyfcaaliqgaqklvfgqgtrltinpniqnpdpavyql
    rdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfa
    canafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ialC (C:)
    iqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrlsa
    ttvaterysllyisssqttdsgvyfcaaliqgaqklvfgqgtrltinpniqnpdpavyql
    rdskksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfacan
    afnnsiipedtffps
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ialD (D:)
    nagvtqtpkfrilkigqsmtlqctqdmnhnymywyrqdpgmglkliyysvgagitdkgev
    pngynvsrsttedfplrlelaapsqtsvyfcastyhgtgyfgegswltvvedlnkvfppe
    vavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqplkeqpaln
    dsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgrad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ialD (D:)
    agvtqtpkfrilkigqsmtlqctqdmnhnymywyrqdpgmglkliyysvgagitdkgevp
    ngynvsrsttedfplrlelaapsqtsvyfcastyhgtgyfgegswltvvedlnkvfppev
    avfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqplkeqpalnd
    sryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgrad