PDB entry 2iad

View 2iad on RCSB PDB site
Description:
Deposited on 1998-03-13, released 1998-11-18
The last revision prior to the SCOP 1.63 freeze date was dated 1998-11-18, with a file datestamp of 1998-11-18.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.253
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d2iada1, d2iada2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d2iadb1, d2iadb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iadA (A:)
    ieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqgg
    lqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvini
    twlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgleepvlkhwe
    peissadlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iadA (A:)
    ieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqgg
    lqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvini
    twlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgleepvlkhws
    sadlvpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iadB (B:)
    ghatqgvtaasshegnserhfvvqfkgecyytngtqrirlvtryiynreeyvrydsdvge
    yravtelgrpdaeywnsqpeilertraevdtacrhnyegpetstslrrleqpnvaislsr
    tealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtp
    hqgevytchvehpslkspitvewss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iadB (B:)
    ghatqgvtaassherhfvvqfkgecyytngtqrirlvtryiynreeyvrydsdvgeyrav
    telgrpdaeywnsqpeilertraevdtacrhnyegpetstslrrleqpnvaislsrteal
    nhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtphqge
    vytchvehpslkspitvewss