PDB entry 2ia9

View 2ia9 on RCSB PDB site
Description: Structural Genomics, the crystal structure of SpoVG from Bacillus subtilis subsp. subtilis str. 168
Class: structural genomics, unknown function
Keywords: APC85465, SpoVG, Bacillus subtilis subsp. subtilis str. 168, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2006-09-07, released 2006-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.23
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative septation protein spoVG
    Species: Bacillus subtilis [TaxId:1423]
    Gene: spoVG, BSU00490
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28015 (3-End)
      • cloning artifact (1-2)
      • modified residue (3)
      • modified residue (19)
      • modified residue (49)
    Domains in SCOPe 2.08: d2ia9a1, d2ia9a2
  • Chain 'B':
    Compound: Putative septation protein spoVG
    Species: Bacillus subtilis [TaxId:1423]
    Gene: spoVG, BSU00490
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28015 (3-End)
      • cloning artifact (1-2)
      • modified residue (3)
      • modified residue (19)
      • modified residue (49)
    Domains in SCOPe 2.08: d2ia9b2, d2ia9b3
  • Chain 'C':
    Compound: Putative septation protein spoVG
    Species: Bacillus subtilis [TaxId:1423]
    Gene: spoVG, BSU00490
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28015 (3-End)
      • cloning artifact (1-2)
      • modified residue (3)
      • modified residue (19)
      • modified residue (49)
    Domains in SCOPe 2.08: d2ia9c2, d2ia9c3
  • Chain 'D':
    Compound: Putative septation protein spoVG
    Species: Bacillus subtilis [TaxId:1423]
    Gene: spoVG, BSU00490
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28015 (3-99)
      • cloning artifact (1-2)
      • modified residue (3)
      • modified residue (19)
      • modified residue (49)
    Domains in SCOPe 2.08: d2ia9d2, d2ia9d3
  • Chain 'E':
    Compound: Putative septation protein spoVG
    Species: Bacillus subtilis [TaxId:1423]
    Gene: spoVG, BSU00490
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28015 (3-End)
      • cloning artifact (1-2)
      • modified residue (3)
      • modified residue (19)
      • modified residue (49)
    Domains in SCOPe 2.08: d2ia9e2, d2ia9e3
  • Chain 'F':
    Compound: Putative septation protein spoVG
    Species: Bacillus subtilis [TaxId:1423]
    Gene: spoVG, BSU00490
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28015 (3-End)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (19)
      • modified residue (49)
    Domains in SCOPe 2.08: d2ia9f2, d2ia9f3
  • Heterogens: SO4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ia9A (A:)
    snamevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskrtpdgef
    rdithpinsstrgkiqdavlneyhrlgdtealefeeagas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ia9A (A:)
    namevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskrtpdgefr
    dithpinsstrgkiqdavlneyhrlgdtealefe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ia9B (B:)
    snamevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskrtpdgef
    rdithpinsstrgkiqdavlneyhrlgdtealefeeagas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ia9B (B:)
    namevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskrtpdgefr
    dithpinsstrgkiqdavlneyhrlgdtealefee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ia9C (C:)
    snamevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskrtpdgef
    rdithpinsstrgkiqdavlneyhrlgdtealefeeagas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ia9C (C:)
    namevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskrdgefrdi
    thpinsstrgkiqdavlneyhrlgdt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ia9D (D:)
    snamevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskrtpdgef
    rdithpinsstrgkiqdavlneyhrlgdtealefeeagas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ia9D (D:)
    namevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskrtpdgefr
    dithpinsstrgkiqdavlneyhrlgdtealefeeagas
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ia9E (E:)
    snamevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskrtpdgef
    rdithpinsstrgkiqdavlneyhrlgdtealefeeagas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ia9E (E:)
    namevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskefrdithp
    insstrgkiqdavlneyhrlgdte
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ia9F (F:)
    snamevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskrtpdgef
    rdithpinsstrgkiqdavlneyhrlgdtealefeeagas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ia9F (F:)
    snamevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskrrdithp
    insstrgkiqdavlneyhrlgdtealefee