PDB entry 2ia7

View 2ia7 on RCSB PDB site
Description: Crystal structure of putative tail lysozyme (NP_952040.1) from GEOBACTER SULFURREDUCENS at 1.44 A resolution
Class: Unknown function
Keywords: NP_952040.1, putative tail lysozyme, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI
Deposited on 2006-09-07, released 2006-09-19
The last revision prior to the SCOP 1.75 freeze date was dated 2006-09-19, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.169
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tail lysozyme, putative
  Species: Geobacter sulfurreducens
  Gene: NP_952040.1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q74EH6 (Start-133)
    • modified residue (24)
    • modified residue (50)
  Domains in SCOP 1.75: d2ia7a1
• Heterogens: NO3, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2ia7A (A:)
  gmtkareflgtgwkfpvaagadgamvlssaeediaesiriilgtargervmrpdfgcgih
  drvfsvintttlglienevkealilwepriellsvtaspreaaegrllidieyrvrstnt
  rfnlvypfylkesa
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2ia7A (A:)
  amvlssaeediaesiriilgtargervmrpdfgcgihdrvfsvintttlglienevkeal
  ilwepriellsvtaspreaaegrllidieyrvrstntrfnlvypfylkesa