PDB entry 2ia5

View 2ia5 on RCSB PDB site
Description: T4 polynucleotide kinase/phosphatase with bound sulfate and magnesium.
Class: transferase
Keywords: Polynucleotide Kinase Phosphatase Sulfate-Complex, TRANSFERASE
Deposited on 2006-09-07, released 2007-06-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.24
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polynucleotide kinase
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: pseT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ia5a1, d2ia5a2
  • Chain 'B':
    Compound: Polynucleotide kinase
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: pseT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ia5b1, d2ia5b2
  • Chain 'C':
    Compound: Polynucleotide kinase
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: pseT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ia5c1, d2ia5c2
  • Chain 'D':
    Compound: Polynucleotide kinase
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: pseT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ia5d1, d2ia5d2
  • Chain 'E':
    Compound: Polynucleotide kinase
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: pseT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ia5e1, d2ia5e2
  • Chain 'F':
    Compound: Polynucleotide kinase
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: pseT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ia5f1, d2ia5f2
  • Chain 'G':
    Compound: Polynucleotide kinase
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: pseT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ia5g1, d2ia5g2
  • Chain 'H':
    Compound: Polynucleotide kinase
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: pseT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ia5h1, d2ia5h2
  • Chain 'I':
    Compound: Polynucleotide kinase
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: pseT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ia5i1, d2ia5i2
  • Chain 'J':
    Compound: Polynucleotide kinase
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: pseT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ia5j1, d2ia5j2
  • Chain 'K':
    Compound: Polynucleotide kinase
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: pseT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ia5k1, d2ia5k2
  • Chain 'L':
    Compound: Polynucleotide kinase
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: pseT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ia5l1, d2ia5l2
  • Heterogens: MG, SO4, ARS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ia5A (A:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngrgpyd
    lekcdtdvinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvpl
    vmqcqreqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgd
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ia5A (A:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngpydlc
    dtdvinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvplvmqc
    qreqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgdf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ia5B (B:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngrgpyd
    lekcdtdvinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvpl
    vmqcqreqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgd
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ia5B (B:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmnggpydl
    ekcdtdvinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvplv
    mqcqreqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgdf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ia5C (C:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngrgpyd
    lekcdtdvinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvpl
    vmqcqreqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgd
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ia5C (C:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngpydle
    kcdtdvinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvplvm
    qcqreqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgdf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ia5D (D:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngrgpyd
    lekcdtdvinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvpl
    vmqcqreqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgd
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ia5D (D:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngrgpyd
    lekcdtdvinpmvvelskmyalmgyqivvvsgresptkyyrmtrkwvediagvplvmqcq
    reqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgdf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ia5E (E:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngrgpyd
    lekcdtdvinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvpl
    vmqcqreqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgd
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ia5E (E:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngekcdt
    dvinpmvvelskmyalmgyqivvvsgresgtedptkyyrmtrkwvediagvplvmqcqre
    qgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgdf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ia5F (F:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngrgpyd
    lekcdtdvinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvpl
    vmqcqreqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgd
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ia5F (F:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmnpydlek
    cdtdvinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvplvmq
    cqreqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgdf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2ia5G (G:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngrgpyd
    lekcdtdvinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvpl
    vmqcqreqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgd
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ia5G (G:)
    kiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegivtg
    mqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelvkr
    nskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmnpydlcdtd
    vinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvplvmqcqre
    qgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgdf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ia5H (H:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngrgpyd
    lekcdtdvinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvpl
    vmqcqreqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgd
    f
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2ia5I (I:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngrgpyd
    lekcdtdvinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvpl
    vmqcqreqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgd
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ia5I (I:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaherdeykytkkegivtg
    mqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelvkr
    nskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmnkcdtdvin
    pmvvelskmyalmgyqivvvsgresgtdptkyyrmtrkwvediagvplvmqcqreqgdtr
    kddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgdf
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2ia5J (J:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngrgpyd
    lekcdtdvinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvpl
    vmqcqreqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgd
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ia5J (J:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmnpydlcd
    tdvinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvplvmqcq
    reqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgdf
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2ia5K (K:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngrgpyd
    lekcdtdvinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvpl
    vmqcqreqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgd
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ia5K (K:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmnkcdtdv
    inpmvvelskmyalmgyqivvvsgresptkyyrmtrkwvediagvplvmqcqreqgdtrk
    ddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgdf
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2ia5L (L:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngrgpyd
    lekcdtdvinpmvvelskmyalmgyqivvvsgresgtkedptkyyrmtrkwvediagvpl
    vmqcqreqgdtrkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgd
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ia5L (L:)
    mkkiiltigcpgsgkstwarefiaknpgfyninrddyrqsimaheerdeykytkkkegiv
    tgmqfdtaksilyggdsvkgviisdtnlnperrlawetfakeygwkvehkvfdvpwtelv
    krnskrgtkavpidvlrsmyksmreylglpvyngtpgkpkavifdvdgtlakmngpydkc
    dtdvinpmvvelskmyalmgyqivvvsgrdptkyyrmtrkwvediagvplvmqcqreqgd
    trkddvvkeeifwkhiaphfdvklaiddrtqvvemwrrigvecwqvasgdf