PDB entry 2i9w

View 2i9w on RCSB PDB site
Description: Crystal structure of a sec-c motif containing protein (psyc_2064) from psychrobacter arcticus at 1.75 A resolution
Class: metal binding protein
Keywords: Cystatin-like fold, sec-c motif fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, metal binding protein
Deposited on 2006-09-06, released 2006-09-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.194
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Psychrobacter arcticus [TaxId:334543]
    Gene: YP_265345.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4FPZ7 (1-183)
      • modified residue (1)
      • modified residue (56)
      • modified residue (159)
      • modified residue (181)
    Domains in SCOPe 2.03: d2i9wa1, d2i9wa2, d2i9wa3
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2i9wA (A:)
gmlfsiqtcpcqinpalnavstpllyqdccqpyhdglynqevedsdairadtaehlmrtr
ysafvlvkpeyivkttlpaqqdlldikaienwaketdwaglevvahtpklskrhaqvefk
ayfktpdglqahhelstfvkiknkansdaswyfldptvsmsvtqkqpcicgsgekfkrcc
gmyi

    Sequence, based on observed residues (ATOM records): (download) 
    >2i9wA (A:)
mlfsiqtcpcqinpalnavstpllyqdccqpyhdglynqairadtaehlmrtrysafvlv
kpeyivkttlpaqqdlldikaienwaketdwaglevvahtpklskrhaqvefkayfktpd
glqahhelstfvkiknkansdaswyfldptvsmsvtqkqpcicgsgekfkrccgmyi