PDB entry 2i9w

View 2i9w on RCSB PDB site
Description: Crystal structure of a sec-c motif containing protein (psyc_2064) from psychrobacter arcticus at 1.75 A resolution
Class: metal binding protein
Keywords: Cystatin-like fold, sec-c motif fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, metal binding protein
Deposited on 2006-09-06, released 2006-09-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Psychrobacter arcticus [TaxId:334543]
    Gene: YP_265345.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4FPZ7 (1-183)
      • modified residue (1)
      • modified residue (56)
      • modified residue (159)
      • modified residue (181)
    Domains in SCOPe 2.08: d2i9wa1, d2i9wa2, d2i9wa3
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i9wA (A:)
    gmlfsiqtcpcqinpalnavstpllyqdccqpyhdglynqevedsdairadtaehlmrtr
    ysafvlvkpeyivkttlpaqqdlldikaienwaketdwaglevvahtpklskrhaqvefk
    ayfktpdglqahhelstfvkiknkansdaswyfldptvsmsvtqkqpcicgsgekfkrcc
    gmyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i9wA (A:)
    mlfsiqtcpcqinpalnavstpllyqdccqpyhdglynqairadtaehlmrtrysafvlv
    kpeyivkttlpaqqdlldikaienwaketdwaglevvahtpklskrhaqvefkayfktpd
    glqahhelstfvkiknkansdaswyfldptvsmsvtqkqpcicgsgekfkrccgmyi