PDB entry 2i9u

View 2i9u on RCSB PDB site
Description: Crystal Structure of Guanine Deaminase from C. acetobutylicum with bound guanine in the active site
Class: hydrolase
Keywords: Protein Structure Initiative II (PSI-II), 9246a, Amidohydrolase, Guanine Deaminase, Nucleotide transport and metabolism, Structural Genomics, New York SGX Research Center for Structural Genomics, NYSGXRC, HYDROLASE
Deposited on 2006-09-06, released 2006-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.194
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytosine/guanine deaminase related protein
    Species: Clostridium acetobutylicum [TaxId:272562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2i9ua1, d2i9ua2
  • Chain 'B':
    Compound: Cytosine/guanine deaminase related protein
    Species: Clostridium acetobutylicum [TaxId:272562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2i9ub1, d2i9ub2
  • Heterogens: FE, GUN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i9uA (A:)
    msllekdinlkifkgnliftktsdkftimkdsyivvidgkiasvssnlpdkykgnpiidf
    rnniiipgmndlhahasqyknlgigmdkellpwlnnytfpeeakflnvdyakktygrlik
    dlikngttrvalfatlhkdstielfnmliksgigayvgkvnmdyncpdyltenyitslnd
    teeiilkykdksnivkpiitprfvpscsnelmdglgklsykyrlpvqshlsenldeiavv
    kslhkksnfygevydkfglfgntptlmahcihsskeeinlikrnnvtivhcptsnfnlgs
    gmmpvrkylnlginvvlgsdisaghtcslfkviayaiqnskikwqesgkkdmflstseaf
    ymatkkggsffgkvgsfeegydfdalvindsnlypedydlterlerfiylgddrnimkry
    vcgneifgpkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i9uA (A:)
    nlkifkgnliftktsdkftimkdsyivvidgkiasvssnlpdkykgnpiidfrnniiipg
    mndlhahasqyknlgigmdkellpwlnnytfpeeakflnvdyakktygrlikdlikngtt
    rvalfatlhkdstielfnmliksgigayvgkvnmdyncpdyltenyitslndteeiilky
    kdksnivkpiitprfvpscsnelmdglgklsykyrlpvqshlsenldeiavvkslhkksn
    fygevydkfglfgntptlmahcihsskeeinlikrnnvtivhcptsnfnlgsgmmpvrky
    lnlginvvlgsdisaghtcslfkviayaiqnskikwqesgkkdmflstseafymatkkgg
    sffgkvgsfeegydfdalvindsnlypedydlterlerfiylgddrnimkryvcgneif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i9uB (B:)
    msllekdinlkifkgnliftktsdkftimkdsyivvidgkiasvssnlpdkykgnpiidf
    rnniiipgmndlhahasqyknlgigmdkellpwlnnytfpeeakflnvdyakktygrlik
    dlikngttrvalfatlhkdstielfnmliksgigayvgkvnmdyncpdyltenyitslnd
    teeiilkykdksnivkpiitprfvpscsnelmdglgklsykyrlpvqshlsenldeiavv
    kslhkksnfygevydkfglfgntptlmahcihsskeeinlikrnnvtivhcptsnfnlgs
    gmmpvrkylnlginvvlgsdisaghtcslfkviayaiqnskikwqesgkkdmflstseaf
    ymatkkggsffgkvgsfeegydfdalvindsnlypedydlterlerfiylgddrnimkry
    vcgneifgpkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i9uB (B:)
    nlkifkgnliftktsdkftimkdsyivvidgkiasvssnlpdkykgnpiidfrnniiipg
    mndlhahasqyknlgigmdkellpwlnnytfpeeakflnvdyakktygrlikdlikngtt
    rvalfatlhkdstielfnmliksgigayvgkvnmdyncpdyltenyitslndteeiilky
    kdksnivkpiitprfvpscsnelmdglgklsykyrlpvqshlsenldeiavvkslhkksn
    fygevydkfglfgntptlmahcihsskeeinlikrnnvtivhcptsnfnlgsgmmpvrky
    lnlginvvlgsdisaghtcslfkviayaiqnskikwqesgkkdmflstseafymatkkgg
    sffgkvgsfeegydfdalvindsnlypedydlterlerfiylgddrnimkryvcgneif