PDB entry 2i9t

View 2i9t on RCSB PDB site
Description: Structure of NF-kB p65-p50 heterodimer bound to PRDII element of B-interferon promoter
Class: transcription/DNA
Keywords: protein-DNA complex, transcription-DNA complex
Deposited on 2006-09-06, released 2007-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription factor p65
    Species: Mus musculus [TaxId:10090]
    Gene: Rela, Nfkb3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04207 (6-278)
      • cloning artifact (4-5)
    Domains in SCOPe 2.08: d2i9ta1, d2i9ta2, d2i9ta3
  • Chain 'B':
    Compound: Nuclear factor NF-kappa-B p105 subunit
    Species: Mus musculus [TaxId:10090]
    Gene: NFKB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2i9tb1, d2i9tb2
  • Chain 'C':
    Compound: 5'-d(*ap*gp*tp*gp*gp*gp*ap*ap*ap*tp*tp*cp*cp*tp*cp*tp*g)-3'
  • Chain 'D':
    Compound: 5'-d(*cp*ap*gp*ap*gp*gp*ap*ap*tp*tp*tp*cp*cp*cp*ap*cp*t)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i9tA (A:)
    gshmhapyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtv
    rislvtkdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisq
    riqtnnnpfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapnta
    elkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaivf
    rtppyadpslqapvrvsmqlrrpsdrelsepmefqylpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i9tA (A:)
    hapyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrisl
    vtkdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqt
    nnnpfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapntaelki
    crvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaivfrtpp
    yadpslqapvrvsmqlrrpsdrelsepmefqylpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i9tB (B:)
    mgpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivql
    vtngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmte
    acirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftaf
    lpdstgsftrrlepvvsdaiydskapnasnlkivrmdrtagcvtggeeiyllcdkvqkdd
    iqirfyeeeenggvwegfgdfsptdvhrqfaivfktpkykdvnitkpasvfvqlrrksdl
    etsepkpflyype
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i9tB (B:)
    gpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivqlv
    tngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmtea
    cirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftafl
    pdstgsftrrlepvvsdaiydskapnasnlkivrmdrtagcvtggeeiyllcdkvqkddi
    qirfyeeeenggvwegfgdfsptdvhrqfaivfktpkykdvnitkpasvfvqlrrksdle
    tsepkpflyype
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.