PDB entry 2i9p

View 2i9p on RCSB PDB site
Description: Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
Class: oxidoreductase
Keywords: 3-hydroxyacid dehydrogenase, Structural Genomics, Structural Genomics Consortium, SGC, OXIDOREDUCTASE
Deposited on 2006-09-06, released 2006-09-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.176
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyisobutyrate dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HIBADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31937 (23-End)
      • cloning artifact (22)
    Domains in SCOPe 2.05: d2i9pa1, d2i9pa2
  • Chain 'B':
    Compound: 3-hydroxyisobutyrate dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HIBADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31937 (23-End)
      • cloning artifact (22)
    Domains in SCOPe 2.05: d2i9pb1, d2i9pb2
  • Chain 'C':
    Compound: 3-hydroxyisobutyrate dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HIBADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31937 (23-End)
      • cloning artifact (22)
    Domains in SCOPe 2.05: d2i9pc1, d2i9pc2
  • Chain 'D':
    Compound: 3-hydroxyisobutyrate dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HIBADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31937 (23-End)
      • cloning artifact (22)
    Domains in SCOPe 2.05: d2i9pd1, d2i9pd2
  • Heterogens: NAD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i9pA (A:)
    mhhhhhhssgvdlgtenlyfqsmpvgfiglgnmgnpmaknlmkhgypliiydvfpdacke
    fqdageqvvsspadvaekadriitmlptsinaieaysgangilkkvkkgsllidsstidp
    avskelakevekmgavfmdapvsggvgaarsgnltfmvggvedefaaaqellgcmgsnvv
    ycgavgtgqaakicnnmllaismigtaeamnlgirlgldpkllakilnmssgrcwssdty
    npvpgvmdgvpsannyqggfgttlmakdlglaqdsatstkspillgslahqiyrmmcakg
    yskkdfssvfqflreeetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i9pA (A:)
    mpvgfiglgnmgnpmaknlmkhgypliiydvfpdackefqdageqvvsspadvaekadri
    itmlptsinaieaysgangilkkvkkgsllidsstidpavskelakevekmgavfmdapv
    sggvgaarsgnltfmvggvedefaaaqellgcmgsnvvycgavgtgqaakicnnmllais
    migtaeamnlgirlgldpkllakilnmssgrcwssdtynpvpgvmdgvpsannyqggfgt
    tlmakdlglaqdsatstkspillgslahqiyrmmcakgyskkdfssvfqflre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i9pB (B:)
    mhhhhhhssgvdlgtenlyfqsmpvgfiglgnmgnpmaknlmkhgypliiydvfpdacke
    fqdageqvvsspadvaekadriitmlptsinaieaysgangilkkvkkgsllidsstidp
    avskelakevekmgavfmdapvsggvgaarsgnltfmvggvedefaaaqellgcmgsnvv
    ycgavgtgqaakicnnmllaismigtaeamnlgirlgldpkllakilnmssgrcwssdty
    npvpgvmdgvpsannyqggfgttlmakdlglaqdsatstkspillgslahqiyrmmcakg
    yskkdfssvfqflreeetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i9pB (B:)
    mpvgfiglgnmgnpmaknlmkhgypliiydvfpdackefqdageqvvsspadvaekadri
    itmlptsinaieaysgangilkkvkkgsllidsstidpavskelakevekmgavfmdapv
    sggvgaarsgnltfmvggvedefaaaqellgcmgsnvvycgavgtgqaakicnnmllais
    migtaeamnlgirlgldpkllakilnmssgrcwssdtynpvpgvmdgvpsannyqggfgt
    tlmakdlglaqdsatstkspillgslahqiyrmmcakgyskkdfssvfqflreeet
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2i9pC (C:)
    mhhhhhhssgvdlgtenlyfqsmpvgfiglgnmgnpmaknlmkhgypliiydvfpdacke
    fqdageqvvsspadvaekadriitmlptsinaieaysgangilkkvkkgsllidsstidp
    avskelakevekmgavfmdapvsggvgaarsgnltfmvggvedefaaaqellgcmgsnvv
    ycgavgtgqaakicnnmllaismigtaeamnlgirlgldpkllakilnmssgrcwssdty
    npvpgvmdgvpsannyqggfgttlmakdlglaqdsatstkspillgslahqiyrmmcakg
    yskkdfssvfqflreeetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i9pC (C:)
    mpvgfiglgnmgnpmaknlmkhgypliiydvfpdackefqdageqvvsspadvaekadri
    itmlptsinaieaysgangilkkvkkgsllidsstidpavskelakevekmgavfmdapv
    sggvgaarsgnltfmvggvedefaaaqellgcmgsnvvycgavgtgqaakicnnmllais
    migtaeamnlgirlgldpkllakilnmssgrcwssdtynpvpgvmdgvpsannyqggfgt
    tlmakdlglaqdsatstkspillgslahqiyrmmcakgyskkdfssvfqflre
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2i9pD (D:)
    mhhhhhhssgvdlgtenlyfqsmpvgfiglgnmgnpmaknlmkhgypliiydvfpdacke
    fqdageqvvsspadvaekadriitmlptsinaieaysgangilkkvkkgsllidsstidp
    avskelakevekmgavfmdapvsggvgaarsgnltfmvggvedefaaaqellgcmgsnvv
    ycgavgtgqaakicnnmllaismigtaeamnlgirlgldpkllakilnmssgrcwssdty
    npvpgvmdgvpsannyqggfgttlmakdlglaqdsatstkspillgslahqiyrmmcakg
    yskkdfssvfqflreeetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i9pD (D:)
    mpvgfiglgnmgnpmaknlmkhgypliiydvfpdackefqdageqvvsspadvaekadri
    itmlptsinaieaysgangilkkvkkgsllidsstidpavskelakevekmgavfmdapv
    sggvgaarsgnltfmvggvedefaaaqellgcmgsnvvycgavgtgqaakicnnmllais
    migtaeamnlgirlgldpkllakilnmssgrcwssdtynpvpgvmdgvpsannyqggfgt
    tlmakdlglaqdsatstkspillgslahqiyrmmcakgyskkdfssvfqflre