PDB entry 2i9l

View 2i9l on RCSB PDB site
Description: Structure of Fab 7D11 from a neutralizing antibody against the poxvirus L1 protein
Class: immune system/viral protein
Keywords: Neutralizing antibody, Poxvirus, antibody complex, IMMUNE SYSTEM-VIRAL PROTEIN COMPLEX
Deposited on 2006-09-05, released 2007-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antibody 7D11 light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2I9L (0-218)
    Domains in SCOPe 2.07: d2i9la1, d2i9la2
  • Chain 'B':
    Compound: Antibody 7D11 heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2I9L (0-218)
  • Chain 'C':
    Compound: Antibody 7D11 light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2I9L (0-218)
    Domains in SCOPe 2.07: d2i9lc1, d2i9lc2
  • Chain 'D':
    Compound: Antibody 7D11 heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2I9L (0-218)
  • Chain 'E':
    Compound: Antibody 7D11 light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2I9L (0-218)
    Domains in SCOPe 2.07: d2i9le1, d2i9le2
  • Chain 'F':
    Compound: Antibody 7D11 heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2I9L (0-218)
  • Chain 'G':
    Compound: Antibody 7D11 light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2I9L (0-218)
    Domains in SCOPe 2.07: d2i9lg1, d2i9lg2
  • Chain 'H':
    Compound: Antibody 7D11 heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2I9L (0-218)
  • Chain 'I':
    Compound: Virion membrane protein M25
    Species: Vaccinia virus [TaxId:10245]
    Gene: l1r
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Virion membrane protein M25
    Species: Vaccinia virus [TaxId:10245]
    Gene: l1r
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Virion membrane protein M25
    Species: Vaccinia virus [TaxId:10245]
    Gene: l1r
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Virion membrane protein M25
    Species: Vaccinia virus [TaxId:10245]
    Gene: l1r
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2i9lA (A:)
    dmvmsqspsslavsagekvsmsckssqtllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsynlwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgseraagvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2i9lC (C:)
    dmvmsqspsslavsagekvsmsckssqtllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsynlwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgseraagvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2i9lE (E:)
    dmvmsqspsslavsagekvsmsckssqtllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsynlwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgseraagvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2i9lG (G:)
    dmvmsqspsslavsagekvsmsckssqtllnsrtrknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsynlwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgseraagvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.