PDB entry 2i9i

View 2i9i on RCSB PDB site
Description: Crystal Structure of Helicobacter pylori protein HP0492
Class: structural genomics, unknown function
Keywords: PSI-2 Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2006-09-05, released 2006-09-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.206
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2i9ia1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i9iA (A:)
    msletktpndaknqvqthermktssehvtpldfnypihivqapqnhhvvgiltpriqvsd
    nlkpyidkfqdalinqiqtifekrgyqvlrfqdekalnaqdkrkifsvldlkgwvgiled
    lkmnlkdpnnpnldtlvdqssgsvwfnfyepesnrvvhdfavevgtfqamtytykhnnsg
    glnssnsiiheyleknkedaihkilnrmyavvmkkavteltkenidkyreaidrmkgfks
    smpqkkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i9iA (A:)
    ermktssehvtpldfnypihivqapqnhhvvgiltpriqvsdnlkpyidkfqdalinqiq
    tifekrgyqvlrfqdekalnaqdkrkifsvldlkgwvgiledlkmnlkdpnnpnldtlvd
    qssgsvwfnfyepesnrvvhdfavevgtfqamtytykhnnsgglnssnsiiheyleknke
    daihkilnrmyavvmkkavteltkenidkyreaidrmkgfk