PDB entry 2i9i

View 2i9i on RCSB PDB site
Description: Crystal Structure of Helicobacter pylori protein HP0492
Class: structural genomics, unknown function
Keywords: PSI-2 Structural Genomics, Protein Structure Initiative, New York Structural GenomiX Research Consortium, NYSGXRC
Deposited on 2006-09-05, released 2006-09-26
The last revision prior to the SCOP 1.75 freeze date was dated 2006-09-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.206
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Helicobacter pylori
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2i9ia1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i9iA (A:)
    msletktpndaknqvqthermktssehvtpldfnypihivqapqnhhvvgiltpriqvsd
    nlkpyidkfqdalinqiqtifekrgyqvlrfqdekalnaqdkrkifsvldlkgwvgiled
    lkmnlkdpnnpnldtlvdqssgsvwfnfyepesnrvvhdfavevgtfqamtytykhnnsg
    glnssnsiiheyleknkedaihkilnrmyavvmkkavteltkenidkyreaidrmkgfks
    smpqkkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i9iA (A:)
    ermktssehvtpldfnypihivqapqnhhvvgiltpriqvsdnlkpyidkfqdalinqiq
    tifekrgyqvlrfqdekalnaqdkrkifsvldlkgwvgiledlkmnlkdpnnpnldtlvd
    qssgsvwfnfyepesnrvvhdfavevgtfqamtytykhnnsgglnssnsiiheyleknke
    daihkilnrmyavvmkkavteltkenidkyreaidrmkgfk