PDB entry 2i96

View 2i96 on RCSB PDB site
Description: Solution structure of the oxidized microsomal human cytochrome b5
Class: electron transport
Keywords: b5 fold, ELECTRON TRANSPORT
Deposited on 2006-09-05, released 2007-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome b5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2i96a_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2i96A (A:)
    maeqsdeavkyytleeiqkhnhskstwlilhhkvydltkfleehpggeevlreqaggdat
    enfedvghstdaremsktfiigelhpddrpklnkppetlittidssss