PDB entry 2i91

View 2i91 on RCSB PDB site
Description: 60kDa Ro autoantigen in complex with a fragment of misfolded RNA
Class: RNA Binding Protein/RNA
Keywords: von Willebrand factor A, Rossmann-fold, HEAT repeat, MIDAS motif, RNA Binding Protein/RNA COMPLEX
Deposited on 2006-09-04, released 2006-10-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.241
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 60 kDa SS-A/Ro ribonucleoprotein
    Species: Xenopus laevis [TaxId:8355]
    Gene: trove2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2i91a1, d2i91a2
  • Chain 'B':
    Compound: 60 kDa SS-A/Ro ribonucleoprotein
    Species: Xenopus laevis [TaxId:8355]
    Gene: trove2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2i91b1, d2i91b2
  • Chain 'C':
    Compound: 5'-r(*gp*cp*cp*up*ap*cp*cp*c)-3'
  • Chain 'D':
    Compound: 5'-r(*c*gp*gp*up*ap*gp*gp*cp*up*up*up*up*cp*ap*a)-3'
  • Chain 'E':
    Compound: 5'-r(*gp*cp*cp*up*ap*cp*cp*c)-3'
  • Chain 'F':
    Compound: 5'-r(*c*gp*gp*up*ap*gp*gp*cp*up*up*up*up*cp*ap*a)-3'
  • Heterogens: ACT, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i91A (A:)
    meatmdqtqplnekqvpnsegcyvwqvsdmnrlrrflcfgseggtyyieekklgqenaea
    llrliedgkgcevvqeiktfsqegraakqeptlfalavcsqcsdiktkqaafravpevcr
    ipthlftfiqfkkdlkegmkcgmwgralrkavsdwyntkdalnlamavtkykqrngwshk
    dllrlshikpanegltmvakyvskgwkevqeaykekelspetekvlkyleatervkrtkd
    eleiihlideyrlvrehlltihlkskeiwksllqdmpltallrnlgkmtadsvlapasse
    vssvcerltnekllkkarihpfhilvaletykkghgnrgklrwipdtsivealdnafyks
    fklveptgkrfllaidvsasmnqrvlgsilnasvvaaamcmlvartekdshmvafsdeml
    pcpitvnmllhevvekmsditmgstdcalpmlwaqktntaadifivftdcetnvedvhpa
    talkqyrekmgipaklivcamtsngfsiadpddrgmldicgfdsgaldvirnftldli
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i91A (A:)
    mdqtqplnekqvpnsegcyvwqvsdmnrlrrflcfgseggtyyieekklgqenaeallrl
    iedgkgcevvqeiktfsqegraakqeptlfalavcsqcsdiktkqaafravpevcripth
    lftfiqfkkdlwgralrkavsdwyntkdalnlamavtkykqrngwshkdllrlshikpan
    egltmvakyvskgwkevqeayspetekvlkyleatervkrtkdeleiihlideyrlvreh
    lltihlkskeiwksllqdmpltallrnlgkmtadsvlapassevssvcerltnekllkka
    rihpfhilvaletykkghgnrgklrwipdtsivealdnafyksfklveptgkrfllaidv
    sasmnqrvlgsilnasvvaaamcmlvartekdshmvafsdemlpcpitvnmllhevvekm
    sditmgstdcalpmlwaqktntaadifivftdcetnvedvhpatalkqyrekmgipakli
    vcamtsngfsiadpddrgmldicgfdsgaldvirnftldl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i91B (B:)
    meatmdqtqplnekqvpnsegcyvwqvsdmnrlrrflcfgseggtyyieekklgqenaea
    llrliedgkgcevvqeiktfsqegraakqeptlfalavcsqcsdiktkqaafravpevcr
    ipthlftfiqfkkdlkegmkcgmwgralrkavsdwyntkdalnlamavtkykqrngwshk
    dllrlshikpanegltmvakyvskgwkevqeaykekelspetekvlkyleatervkrtkd
    eleiihlideyrlvrehlltihlkskeiwksllqdmpltallrnlgkmtadsvlapasse
    vssvcerltnekllkkarihpfhilvaletykkghgnrgklrwipdtsivealdnafyks
    fklveptgkrfllaidvsasmnqrvlgsilnasvvaaamcmlvartekdshmvafsdeml
    pcpitvnmllhevvekmsditmgstdcalpmlwaqktntaadifivftdcetnvedvhpa
    talkqyrekmgipaklivcamtsngfsiadpddrgmldicgfdsgaldvirnftldli
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i91B (B:)
    mdqtqplnekqvpnsegcyvwqvsdmnrlrrflcfgseggtyyieekklgqenaeallrl
    iedgkgcevvqeiktfsqegraakqeptlfalavcsqcsdiktkqaafravpevcripth
    lftfiqfkkdlkwgralrkavsdwyntkdalnlamavtkykqrngwshkdllrlshikpa
    negltmvakyvskgwkevqeaykekelspetekvlkyleatervkrtkdeleiihlidey
    rlvrehlltihlkskeiwksllqdmpltallrnlgkmtadsvlapassevssvcerltne
    kllkkarihpfhilvaletykkghgnrgklrwipdtsivealdnafyksfklveptgkrf
    llaidvsasmnqrvlgsilnasvvaaamcmlvartekdshmvafsdemlpcpitvnmllh
    evvekmsditmgstdcalpmlwaqktntaadifivftdcetnvedvhpatalkqyrekmg
    ipaklivcamtsngfsiadpddrgmldicgfdsgaldvirnftldl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.