PDB entry 2i8f

View 2i8f on RCSB PDB site
Description: Solution Conformation of the H47A Mutant of Pseudomonas stutzeri ZoBell Ferrocytochrome c-551
Class: electron transport
Keywords: helix-turn-helix, cytochrome, ELECTRON TRANSPORT
Deposited on 2006-09-01, released 2007-06-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c-551
  Species: Pseudomonas stutzeri ZoBell [TaxId:96564]
  Gene: nirM
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00101 (0-81)
    • engineered (46)
  Domains in SCOPe 2.05: d2i8fa_
• Heterogens: HEC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2i8fA (A:)
  qdgealfkskpcaachsvdtkmvgpalkevaaknagvegaadtlalaikngsqgvwgpip
  mppnpvteeeakilaewvlslk