PDB entry 2i85

View 2i85 on RCSB PDB site
Description: NMR solution structure of Human ephrinB2 ectodomain
Class: signaling protein
Keywords: ephrinB2 ectodomain, NMR solution structure, SIGNALING PROTEIN
Deposited on 2006-09-01, released 2007-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ephrin-b2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2i85a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2i85A (A:)
    sksivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkd
    qadrctikkentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngsleg
    ldnqeggvcqtramkilmkvgq