PDB entry 2i7t

View 2i7t on RCSB PDB site
Description: Structure of human CPSF-73
Class: hydrolase, RNA binding protein
Keywords: polyadenylation, metallo-B-lactamase, pre-mRNA processing, Artemis, V(D)J recombination, double-strand break repair, HYDROLASE, RNA BINDING PROTEIN
Deposited on 2006-08-31, released 2007-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cleavage and polyadenylation specificity factor 73 kDa subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: CPSF3, CPSF73
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2i7ta1
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i7tA (A:)
    msaipaeesdqllirplgagqevgrsciilefkgrkimldcgihpglegmdalpyidlid
    paeidlllishfhldhcgalpwflqktsfkgrtfmthatkaiyrwllsdyvkvsnisadd
    mlytetdleesmdkietinfhevkevagikfwcyhaghvlgaamfmieiagvkllytgdf
    srqedrhlmaaeipnikpdiliiestygthihekreerearfcntvhdivnrggrglipv
    falgraqelllildeywqnhpelhdipiyyasslakkcmavyqtyvnamndkirkqinin
    npfvfkhisnlksmdhfddigpsvvmaspgmmqsglsrelfeswctdkrngviiagycve
    gtlakhimsepeeittmsgqklplkmsvdyisfsahtdyqqtsefiralkpphvilvhge
    qnemarlkaalireyedndevhievhnprnteavtlnfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i7tA (A:)
    sdqllirplgagqevgrsciilefkgrkimldcgihpglegmdalpyidlidpaeidlll
    ishfhldhcgalpwflqktsfkgrtfmthatkaiyrwllsdyvklytetdleesmdkiet
    infhevkevagikfwcyhaghvlgaamfmieiagvkllytgdfsrqmaaeipnikpdili
    iestygthihekreerearfcntvhdivnrggrglipvfalgraqelllildeywqnhpe
    lhdipiyyafkhisnlksmdhfddigpsvvmaspgmmqsglsrelfeswctdkrngviia
    gycvegtlakhimsepeeittmsgqklplkmsvdyisfsahtdyqqtsefiralkpphvi
    lvhgeqnemarlkaalireyedndevhievhnprnteavtlnfr