PDB entry 2i7s

View 2i7s on RCSB PDB site
Description: Crystal structure of Re(phen)(CO)3 (Thr124His)(His83Gln) Azurin Cu(II) from Pseudomonas aeruginosa
Class: electron transport
Keywords: Azurin, Rhenium, Electron Transfer in proteins, ELECTRON TRANSPORT
Deposited on 2006-08-31, released 2006-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-12-08, with a file datestamp of 2009-12-04.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.205
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282
      • conflict (1)
      • engineered (82)
      • engineered (123)
    Domains in SCOPe 2.07: d2i7sa_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282
      • conflict (1)
      • engineered (82)
      • engineered (123)
    Domains in SCOPe 2.07: d2i7sb_
  • Chain 'C':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282
      • conflict (1)
      • engineered (82)
      • engineered (123)
    Domains in SCOPe 2.07: d2i7sc_
  • Chain 'D':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • conflict (1)
      • engineered (82)
      • engineered (123)
    Domains in SCOPe 2.07: d2i7sd_
  • Heterogens: CU, REP, CON, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2i7sA (A:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviaqtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkghltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2i7sB (B:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviaqtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkghltlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2i7sC (C:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviaqtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkghltlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2i7sD (D:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviaqtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkghltlk