PDB entry 2i7r

View 2i7r on RCSB PDB site
Description: conserved domain protein
Class: structural genomics, unknown function
Keywords: structural genomics conserved domain, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2006-08-31, released 2006-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved domain protein
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97RR3 (3-117)
      • modified residue (3)
      • modified residue (48)
      • modified residue (116)
    Domains in SCOPe 2.08: d2i7ra1
  • Chain 'B':
    Compound: conserved domain protein
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97RR3 (3-117)
      • modified residue (3)
      • modified residue (48)
      • modified residue (116)
    Domains in SCOPe 2.08: d2i7rb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i7rA (A:)
    snamnlnqldiivsnvpqvcadlehildkkadyandgfaqftigshclmlsqnhlvplen
    fqsgiiihievedvdqnykrlnelgikvlhgptvtdwgtesllvqgpaglvldfyrmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i7rA (A:)
    mnlnqldiivsnvpqvcadlehildkkadyandgfaqftigshclmlsqnhlvplenfqs
    giiihievedvdqnykrlnelgikvlhgptvtdwgtesllvqgpaglvldfyrmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i7rB (B:)
    snamnlnqldiivsnvpqvcadlehildkkadyandgfaqftigshclmlsqnhlvplen
    fqsgiiihievedvdqnykrlnelgikvlhgptvtdwgtesllvqgpaglvldfyrmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i7rB (B:)
    mnlnqldiivsnvpqvcadlehildkkadyandgfaqftigshclmlsqnhlvplenfqs
    giiihievedvdqnykrlnelgikvlhgptvtdwgtesllvqgpaglvldfyrmk