PDB entry 2i7o

View 2i7o on RCSB PDB site
Description: Structure of Re(4,7-dimethyl-phen)(Thr124His)(Lys122Trp)(His83Gln)AzCu(II), a Rhenium modified Azurin mutant
Class: electron transport
Keywords: Azurin, Rhenium, Elecron Transfer, Tryptophan, ELECTRON TRANSPORT
Deposited on 2006-08-31, released 2007-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.236
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • conflict (1)
      • engineered (82)
      • engineered (121)
      • engineered (123)
    Domains in SCOPe 2.07: d2i7oa_
  • Heterogens: CU, REQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2i7oA (A:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviaqtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mwghltlk