PDB entry 2i7k

View 2i7k on RCSB PDB site
Description: Solution Structure of the Bromodomain of Human BRD7 Protein
Class: transcription
Keywords: Helix, Left-handed four-helix bundle, TRANSCRIPTION
Deposited on 2006-08-31, released 2007-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bromodomain-containing protein 7
  Species: Homo sapiens [TaxId:9606]
  Gene: BRD7
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NPI1 (1-108)
    • cloning artifact (0)
    • expression tag (109-116)
  Domains in SCOPe 2.08: d2i7ka1, d2i7ka2, d2i7ka3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2i7kA (A:)
  meeveqtplqealnqlmrqlqrkdpsaffsfpvtdfiapgysmiikhpmdfstmkekikn
  ndyqsieelkdnfklmctnamiynkpetiyykaakkllhsgmkilsqerlehhhhhh