PDB entry 2i76

View 2i76 on RCSB PDB site
Description: Crystal structure of protein TM1727 from Thermotoga maritima
Class: structural genomics, unknown function
Keywords: NADP, dehydrogenase, TM1727, T1650, Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION
Deposited on 2006-08-30, released 2006-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.236
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X250 (3-End)
      • modified residue (119)
      • modified residue (197)
      • modified residue (207)
    Domains in SCOPe 2.07: d2i76a1, d2i76a2
  • Chain 'B':
    Compound: hypothetical protein
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X250 (3-End)
      • modified residue (119)
      • modified residue (197)
      • modified residue (207)
    Domains in SCOPe 2.07: d2i76b1, d2i76b2
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i76A (A:)
    mslvlnfvgtgtltrffleclkdryeigyilsrsidrarnlaevyggkaatlekhpelng
    vvfvivpdryiktvanhlnlgdavlvhcsgflsseifkksgrasihpnfsfsslekalem
    kdqivfglegderglpivkkiaeeisgkyfvipsekkkayhlaaviasnfpvalaylskr
    iytllgldepellihtlmkgvadnikkmrvecsltgpvkrgdwqvveeerreyekifgnt
    vlydeivkllrevaeserreaqedereggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i76A (A:)
    vlnfvgtgtltrffleclkigyilsrsidrarnlaevyggkaatlekhpevvfvivpdry
    iktvanhlnlgdavlvhcsgflsseifkksgrasihpnfsflekalemkdqivfglegde
    rglpivkkiaeeisgkyfvipsekkkayhlaaviasnfpvalaylskriytllgldepel
    lihtlmkgvadnikkmrvecsltgpvkrgdwqvveeerreyekifgntvlydeivkllre
    vaeserr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i76B (B:)
    mslvlnfvgtgtltrffleclkdryeigyilsrsidrarnlaevyggkaatlekhpelng
    vvfvivpdryiktvanhlnlgdavlvhcsgflsseifkksgrasihpnfsfsslekalem
    kdqivfglegderglpivkkiaeeisgkyfvipsekkkayhlaaviasnfpvalaylskr
    iytllgldepellihtlmkgvadnikkmrvecsltgpvkrgdwqvveeerreyekifgnt
    vlydeivkllrevaeserreaqedereggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i76B (B:)
    vlnfvgtgtltrffleclkigyilsrsidrarnlaevyggkaatlekhpevvfvivpdry
    iktvanhlnlgdavlvhcsgflsseifkksgrasihpnfsflekalemkdqivfglegde
    rglpivkkiaeeisgkyfviekkkayhlaaviasnfpvalaylskriytllgldepelli
    htlmkgvadnikkmrvecsltgpvkrgdwqvveeerreyekifgntvlydeivkllreva
    es