PDB entry 2i74

View 2i74 on RCSB PDB site
Description: Crystal structure of mouse Peptide N-Glycanase C-terminal domain in complex with mannopentaose
Class: hydrolase
Keywords: beta-sandwich, HYDROLASE
Deposited on 2006-08-30, released 2006-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.7500000000000002 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PNGase
    Species: Mus musculus [TaxId:10090]
    Gene: Ngly1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2i74a1
  • Chain 'B':
    Compound: PNGase
    Species: Mus musculus [TaxId:10090]
    Gene: Ngly1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2i74b_
  • Heterogens: ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i74A (A:)
    lerkeilfipsenekiskqfhlrydivrdryirvsdnntnisgwengvwkmesifrkvek
    dwnmvylarkegssfayiswkfecgsaglkvdtvsirtssqsfesgsvrwklrsetaqvn
    llgdknlrsyndfsgatevtleaelsrgdgdvawqhtqlfrqslndsgengleiiitfnd
    llehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i74A (A:)
    erkeilfipsenekiskqfhlrydivrdryirvsdnntnisgwengvwkmesifrkvekd
    wnmvylarkegssfayiswkfecgsaglkvdtvsirtssqsfesgsvrwklrsetaqvnl
    lgdknlrsyndfsgatevtleaelsrgdgdvawqhtqlfrqslndsgengleiiitfndl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i74B (B:)
    lerkeilfipsenekiskqfhlrydivrdryirvsdnntnisgwengvwkmesifrkvek
    dwnmvylarkegssfayiswkfecgsaglkvdtvsirtssqsfesgsvrwklrsetaqvn
    llgdknlrsyndfsgatevtleaelsrgdgdvawqhtqlfrqslndsgengleiiitfnd
    llehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i74B (B:)
    erkeilfipsenekiskqfhlrydivrdryirvsdnntnisgwengvwkmesifrkvekd
    wnmvylarkegssfayiswkfecgsaglkvdtvsirtssqsfesgsvrwklrsetaqvnl
    lgdknlrsyndfsgatevtleaelsrgdgdvawqhtqlfrqslndsgengleiiitfndl