PDB entry 2i6v

View 2i6v on RCSB PDB site
Description: PDZ domain of EpsC from Vibrio cholerae, residues 219-305
Class: protein transport, membrane protein
Keywords: EpsC, GspC, PDZ domain, Type 2 Secretion System, General Secretion Pathway, PROTEIN TRANSPORT, MEMBRANE PROTEIN
Deposited on 2006-08-29, released 2006-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.6300000000000001 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: General secretion pathway protein C
    Species: Vibrio cholerae [TaxId:666]
    Gene: epsC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2i6va1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2i6vA (A:)
    qeifqyvrlsqvkrddkvlgyrvspgkdpvlfesiglqdgdmavalngldltdpnvmntl
    fqsmnemtemsltverdgqqhdvyiqf