PDB entry 2i6t

View 2i6t on RCSB PDB site
Description: Orthorhombic Structure of the LDH domain of Human Ubiquitin-conjugating Enzyme E2-like Isoform A
Class: unknown function
Keywords: L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein ligase, UNKNOWN FUNCTION
Deposited on 2006-08-29, released 2006-10-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.183
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme e2-like isoform a
    Species: Homo sapiens [TaxId:9606]
    Gene: UEVLD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2i6ta1, d2i6ta2
  • Chain 'B':
    Compound: ubiquitin-conjugating enzyme e2-like isoform a
    Species: Homo sapiens [TaxId:9606]
    Gene: UEVLD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2i6tb1, d2i6tb2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i6tA (A:)
    gsskswanhenktvnkitvvgggelgiactlaisakgiadrlvlldlsegtkgatmdlei
    fnlpnveiskdlsasahskvviftvnslgssqsyldvvqsnvdmfralvpalghysqhsv
    llvasqpveimtyvtwklstfpanrvigigcnldsqrlqyiitnvlkaqtsgkevwvige
    qgedkvltwsgqeevvshtsqvqlsnramellrvkgqrswsvglsvadmvdsivnnkkkv
    hsvsalakgyydinsevflslpcilgtngvsevikttlkedtvteklqssassihslqqq
    lkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i6tA (A:)
    vnkitvvgggelgiactlaisakgiadrlvlldlsatmdleifnlpnveiskdlsasahs
    kvviftvnsqsyldvvqsnvdmfralvpalghysqhsvllvasqpveimtyvtwklstfp
    anrvigigcnldsqrlqyiitnvlkaqtsgkevwvigeqgedkvltwsgqeevvshtsqv
    qlsnramellrvkgqrswsvglsvadmvdsivnnkkkvhsvsalakgyydinsevflslp
    cilgtngvsevikttledtvteklqssassihslqqqlkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i6tB (B:)
    gsskswanhenktvnkitvvgggelgiactlaisakgiadrlvlldlsegtkgatmdlei
    fnlpnveiskdlsasahskvviftvnslgssqsyldvvqsnvdmfralvpalghysqhsv
    llvasqpveimtyvtwklstfpanrvigigcnldsqrlqyiitnvlkaqtsgkevwvige
    qgedkvltwsgqeevvshtsqvqlsnramellrvkgqrswsvglsvadmvdsivnnkkkv
    hsvsalakgyydinsevflslpcilgtngvsevikttlkedtvteklqssassihslqqq
    lkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i6tB (B:)
    vnkitvvgggelgiactlaisakgiadrlvlldlseggatmdleifnlpnveiskdlsas
    ahskvviftvnsqsyldvvqsnvdmfralvpalghysqhsvllvasqpveimtyvtwkls
    tfpanrvigigcnldsqrlqyiitnvlkaqtsgkevwvigeqgedkvltwsgqeevvsht
    sqvqlsnramellrvkgqrswsvglsvadmvdsivnnkkkvhsvsalakgyydinsevfl
    slpcilgtngvsevikttlktvteklqssassihslqqqlkl