PDB entry 2i6e

View 2i6e on RCSB PDB site
Description: Crystal structure of protein DR0370 from Deinococcus radiodurans, Pfam DUF178
Class: structural genomics, unknown function
Keywords: hypothetical protein,Pfam:DUF178, NYSGXRC,10093b, Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2006-08-28, released 2006-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.202
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DR_0370
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RXE3
      • modified residue (49)
      • modified residue (114)
      • modified residue (174)
      • modified residue (222)
    Domains in SCOPe 2.07: d2i6ea1
  • Chain 'B':
    Compound: hypothetical protein
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DR_0370
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RXE3
      • modified residue (49)
      • modified residue (114)
      • modified residue (174)
      • modified residue (222)
    Domains in SCOPe 2.07: d2i6eb_
  • Chain 'C':
    Compound: hypothetical protein
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DR_0370
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RXE3
      • modified residue (49)
      • modified residue (114)
      • modified residue (174)
      • modified residue (222)
    Domains in SCOPe 2.07: d2i6ec_
  • Chain 'D':
    Compound: hypothetical protein
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DR_0370
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RXE3
      • modified residue (49)
      • modified residue (114)
      • modified residue (174)
      • modified residue (222)
    Domains in SCOPe 2.07: d2i6ed_
  • Chain 'E':
    Compound: hypothetical protein
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DR_0370
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RXE3
      • modified residue (49)
      • modified residue (114)
      • modified residue (174)
      • modified residue (222)
    Domains in SCOPe 2.07: d2i6ee_
  • Chain 'F':
    Compound: hypothetical protein
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DR_0370
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RXE3
      • modified residue (49)
      • modified residue (114)
      • modified residue (174)
      • modified residue (222)
    Domains in SCOPe 2.07: d2i6ef_
  • Chain 'G':
    Compound: hypothetical protein
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DR_0370
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RXE3
      • modified residue (49)
      • modified residue (114)
      • modified residue (174)
      • modified residue (222)
    Domains in SCOPe 2.07: d2i6eg_
  • Chain 'H':
    Compound: hypothetical protein
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DR_0370
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RXE3
      • modified residue (49)
      • modified residue (114)
      • modified residue (174)
      • modified residue (222)
    Domains in SCOPe 2.07: d2i6eh_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i6eA (A:)
    msltnhhpsstgpqhpyragwihftnvapildslelppgvtaitgvptqmnaallsgevd
    ianvsavefirhadtlaalpdfsvavlgpvysvnlfhtcplpelrrvaltsqsamsvall
    evllrqkglspvleraegtaesllaagydgvlrigddalrewygvvgpltpertmtslph
    tgrgitvtdlaqewfdltghpftfavwayrkdnpppaallqamrearrrgighlaevsqr
    haeklglpervvqhylwnfryhleapdrlglrefadlavpghaeltfgareeaeghhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i6eA (A:)
    pyragwihftnvapildslelppgvtaitgvptqmnaallsgevdianvsavefirhadt
    laalpdfsvavlgpvysvnlfhtcplpelrrvaltsqsamsvallevllrqkglspvler
    aegtaesllaagydgvlrigddalrewygvvgpltpertmtslphtgrgitvtdlaqewf
    dltghpftfavwayrkdnpppaallqamrearrrgighlaevsqrhaeklglpervvqhy
    lwnfryhleapdrlglrefadlavpghaeltf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i6eB (B:)
    msltnhhpsstgpqhpyragwihftnvapildslelppgvtaitgvptqmnaallsgevd
    ianvsavefirhadtlaalpdfsvavlgpvysvnlfhtcplpelrrvaltsqsamsvall
    evllrqkglspvleraegtaesllaagydgvlrigddalrewygvvgpltpertmtslph
    tgrgitvtdlaqewfdltghpftfavwayrkdnpppaallqamrearrrgighlaevsqr
    haeklglpervvqhylwnfryhleapdrlglrefadlavpghaeltfgareeaeghhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i6eB (B:)
    pyragwihftnvapildslelppgvtaitgvptqmnaallsgevdianvsavefirhadt
    laalpdfsvavlgpvysvnlfhtcplpelrrvaltsqsamsvallevllrqkglspvler
    aegtaesllaagydgvlrigddalrewygvvgpltpertmtslphtgrgitvtdlaqewf
    dltghpftfavwayrkdnpppaallqamrearrrgighlaevsqrhaeklglpervvqhy
    lwnfryhleapdrlglrefadlavpghaeltf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2i6eC (C:)
    msltnhhpsstgpqhpyragwihftnvapildslelppgvtaitgvptqmnaallsgevd
    ianvsavefirhadtlaalpdfsvavlgpvysvnlfhtcplpelrrvaltsqsamsvall
    evllrqkglspvleraegtaesllaagydgvlrigddalrewygvvgpltpertmtslph
    tgrgitvtdlaqewfdltghpftfavwayrkdnpppaallqamrearrrgighlaevsqr
    haeklglpervvqhylwnfryhleapdrlglrefadlavpghaeltfgareeaeghhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i6eC (C:)
    pyragwihftnvapildslelppgvtaitgvptqmnaallsgevdianvsavefirhadt
    laalpdfsvavlgpvysvnlfhtcplpelrrvaltsqsamsvallevllrqkglspvler
    aegtaesllaagydgvlrigddalrewygvvgpltpertmtslphtgrgitvtdlaqewf
    dltghpftfavwayrkdnpppaallqamrearrrgighlaevsqrhaeklglpervvqhy
    lwnfryhleapdrlglrefadlavpghaeltf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2i6eD (D:)
    msltnhhpsstgpqhpyragwihftnvapildslelppgvtaitgvptqmnaallsgevd
    ianvsavefirhadtlaalpdfsvavlgpvysvnlfhtcplpelrrvaltsqsamsvall
    evllrqkglspvleraegtaesllaagydgvlrigddalrewygvvgpltpertmtslph
    tgrgitvtdlaqewfdltghpftfavwayrkdnpppaallqamrearrrgighlaevsqr
    haeklglpervvqhylwnfryhleapdrlglrefadlavpghaeltfgareeaeghhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i6eD (D:)
    pyragwihftnvapildslelppgvtaitgvptqmnaallsgevdianvsavefirhadt
    laalpdfsvavlgpvysvnlfhtcplpelrrvaltsqsamsvallevllrqkglspvler
    aegtaesllaagydgvlrigddalrewygvvgpltpertmtslphtgrgitvtdlaqewf
    dltghpftfavwayrkdnpppaallqamrearrrgighlaevsqrhaeklglpervvqhy
    lwnfryhleapdrlglrefadlavpghaeltf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2i6eE (E:)
    msltnhhpsstgpqhpyragwihftnvapildslelppgvtaitgvptqmnaallsgevd
    ianvsavefirhadtlaalpdfsvavlgpvysvnlfhtcplpelrrvaltsqsamsvall
    evllrqkglspvleraegtaesllaagydgvlrigddalrewygvvgpltpertmtslph
    tgrgitvtdlaqewfdltghpftfavwayrkdnpppaallqamrearrrgighlaevsqr
    haeklglpervvqhylwnfryhleapdrlglrefadlavpghaeltfgareeaeghhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i6eE (E:)
    pyragwihftnvapildslelppgvtaitgvptqmnaallsgevdianvsavefirhadt
    laalpdfsvavlgpvysvnlfhtcplpelrrvaltsqsamsvallevllrqkglspvler
    aegtaesllaagydgvlrigddalrewygvvgpltpertmtslphtgrgitvtdlaqewf
    dltghpftfavwayrkdnpppaallqamrearrrgighlaevsqrhaeklglpervvqhy
    lwnfryhleapdrlglrefadlavpghaeltf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2i6eF (F:)
    msltnhhpsstgpqhpyragwihftnvapildslelppgvtaitgvptqmnaallsgevd
    ianvsavefirhadtlaalpdfsvavlgpvysvnlfhtcplpelrrvaltsqsamsvall
    evllrqkglspvleraegtaesllaagydgvlrigddalrewygvvgpltpertmtslph
    tgrgitvtdlaqewfdltghpftfavwayrkdnpppaallqamrearrrgighlaevsqr
    haeklglpervvqhylwnfryhleapdrlglrefadlavpghaeltfgareeaeghhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i6eF (F:)
    pyragwihftnvapildslelppgvtaitgvptqmnaallsgevdianvsavefirhadt
    laalpdfsvavlgpvysvnlfhtcplpelrrvaltsqsamsvallevllrqkglspvler
    aegtaesllaagydgvlrigddalrewygvvgpltpertmtslphtgrgitvtdlaqewf
    dltghpftfavwayrkdnpppaallqamrearrrgighlaevsqrhaeklglpervvqhy
    lwnfryhleapdrlglrefadlavpghaeltf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2i6eG (G:)
    msltnhhpsstgpqhpyragwihftnvapildslelppgvtaitgvptqmnaallsgevd
    ianvsavefirhadtlaalpdfsvavlgpvysvnlfhtcplpelrrvaltsqsamsvall
    evllrqkglspvleraegtaesllaagydgvlrigddalrewygvvgpltpertmtslph
    tgrgitvtdlaqewfdltghpftfavwayrkdnpppaallqamrearrrgighlaevsqr
    haeklglpervvqhylwnfryhleapdrlglrefadlavpghaeltfgareeaeghhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i6eG (G:)
    pyragwihftnvapildslelppgvtaitgvptqmnaallsgevdianvsavefirhadt
    laalpdfsvavlgpvysvnlfhtcplpelrrvaltsqsamsvallevllrqkglspvler
    aegtaesllaagydgvlrigddalrewygvvgpltpertmtslphtgrgitvtdlaqewf
    dltghpftfavwayrkdnpppaallqamrearrrgighlaevsqrhaeklglpervvqhy
    lwnfryhleapdrlglrefadlavpghaeltf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2i6eH (H:)
    msltnhhpsstgpqhpyragwihftnvapildslelppgvtaitgvptqmnaallsgevd
    ianvsavefirhadtlaalpdfsvavlgpvysvnlfhtcplpelrrvaltsqsamsvall
    evllrqkglspvleraegtaesllaagydgvlrigddalrewygvvgpltpertmtslph
    tgrgitvtdlaqewfdltghpftfavwayrkdnpppaallqamrearrrgighlaevsqr
    haeklglpervvqhylwnfryhleapdrlglrefadlavpghaeltfgareeaeghhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i6eH (H:)
    pyragwihftnvapildslelppgvtaitgvptqmnaallsgevdianvsavefirhadt
    laalpdfsvavlgpvysvnlfhtcplpelrrvaltsqsamsvallevllrqkglspvler
    aegtaesllaagydgvlrigddalrewygvvgpltpertmtslphtgrgitvtdlaqewf
    dltghpftfavwayrkdnpppaallqamrearrrgighlaevsqrhaeklglpervvqhy
    lwnfryhleapdrlglrefadlavpghaeltf