PDB entry 2i6c

View 2i6c on RCSB PDB site
Description: Crystal structure of putative acetyltransferase (GNAT family) from Pseudomonas aeruginosa PAO1
Class: transferase
Keywords: acetyltransferase, GNAT family, structural genomic, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSFERASE
Deposited on 2006-08-28, released 2006-09-26
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.156
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative acetyltransferase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA4794
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HV14 (0-159)
      • modified residue (0)
      • modified residue (80-81)
      • modified residue (99)
      • modified residue (112)
      • modified residue (153)
    Domains in SCOPe 2.02: d2i6ca1
  • Heterogens: SO4, CL, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2i6cA (A:)
mqlshrpaetgdletvagfpqdrdelfycypkaiwpfsvaqlaaaiaerrgstvavhdgq
vlgfanfyqwqhgdfcalgnmmvapaarglgvaryligvmenlareqykarlmkiscfna
naaglllytqlgyqpraiaerhdpdgrrvaliqmdkplep