PDB entry 2i6b

View 2i6b on RCSB PDB site
Description: Human Adenosine Kinase in Complex with An Acetylinic Inhibitor
Class: transferase
Keywords: Protein-ligand complex, TRANSFERASE
Deposited on 2006-08-28, released 2007-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: adk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2i6ba_
  • Chain 'B':
    Compound: adenosine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: adk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2i6bb_
  • Heterogens: 89I, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i6bA (A:)
    mtsvrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkvey
    haggstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqpt
    gtcaacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvl
    kvahhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkd
    ikeiakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagd
    afvggflsqlvsdkplteciraghyaasiiirrtgctfpekpdfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i6bA (A:)
    tsvrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyh
    aggstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqptg
    tcaacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvlk
    vahhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkdi
    keiakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagda
    fvggflsqlvsdkplteciraghyaasii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i6bB (B:)
    mtsvrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkvey
    haggstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqpt
    gtcaacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvl
    kvahhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkd
    ikeiakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagd
    afvggflsqlvsdkplteciraghyaasiiirrtgctfpekpdfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i6bB (B:)
    svrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyha
    ggstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqptgt
    caacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvlkv
    ahhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkdik
    eiakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagdaf
    vggflsqlvsdkplteciraghyaas