PDB entry 2i6a

View 2i6a on RCSB PDB site
Description: Human Adenosine Kinase in Complex With 5'-Deoxy-5-Iodotubercidin
Class: transferase
Keywords: protein-ligand complex, 5'-deoxy-5-iodotubercidin
Deposited on 2006-08-28, released 2007-01-02
The last revision prior to the SCOP 1.75 freeze date was dated 2007-01-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.181
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine kinase
    Species: HOMO SAPIENS
    Gene: adk
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2i6aa1
  • Chain 'B':
    Compound: adenosine kinase
    Species: HOMO SAPIENS
    Gene: adk
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2i6ab1
  • Chain 'C':
    Compound: adenosine kinase
    Species: HOMO SAPIENS
    Gene: adk
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2i6ac1
  • Chain 'D':
    Compound: adenosine kinase
    Species: HOMO SAPIENS
    Gene: adk
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2i6ad1
  • Heterogens: 5I5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i6aA (A:)
    mtsvrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkvey
    haggstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqpt
    gtcaacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvl
    kvahhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkd
    ikeiakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagd
    afvggflsqlvsdkplteciraghyaasiiirrtgctfpekpdfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i6aA (A:)
    svrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyha
    ggstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqptgt
    caacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvlkv
    ahhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkdik
    eiakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagdaf
    vggflsqlvsdkplteciraghyaasiiirrtgctfpekpdfh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i6aB (B:)
    mtsvrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkvey
    haggstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqpt
    gtcaacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvl
    kvahhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkd
    ikeiakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagd
    afvggflsqlvsdkplteciraghyaasiiirrtgctfpekpdfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i6aB (B:)
    svrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyha
    ggstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqptgt
    caacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvlkv
    ahhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkdik
    eiakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagdaf
    vggflsqlvsdkplteciraghyaasiiirrtgctfpekpdfh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2i6aC (C:)
    mtsvrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkvey
    haggstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqpt
    gtcaacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvl
    kvahhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkd
    ikeiakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagd
    afvggflsqlvsdkplteciraghyaasiiirrtgctfpekpdfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i6aC (C:)
    svrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyha
    ggstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqptgt
    caacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvlkv
    ahhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkdik
    eiakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagdaf
    vggflsqlvsdkplteciraghyaasiiirrtgctfpekpdfh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2i6aD (D:)
    mtsvrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkvey
    haggstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqpt
    gtcaacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvl
    kvahhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkd
    ikeiakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagd
    afvggflsqlvsdkplteciraghyaasiiirrtgctfpekpdfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i6aD (D:)
    svrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyha
    ggstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqptgt
    caacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvlkv
    ahhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkdik
    eiakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagdaf
    vggflsqlvsdkplteciraghyaasiiirrtgctfpekpdfh