PDB entry 2i5w

View 2i5w on RCSB PDB site
Description: Structure of hOGG1 crosslinked to DNA sampling a normal G adjacent to an oxoG
Class: Hydrolase, Lyase/DNA
Keywords: disulfide crosslink, protein-dna complex, DNA glycosylase, Hydrolase, Lyase-DNA COMPLEX
Deposited on 2006-08-26, released 2006-10-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.226
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-glycosylase/DNA lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: OGG1, MMH, MUTM, OGH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15527 (3-314)
      • cloning artifact (0-2)
      • engineered (140)
    Domains in SCOPe 2.06: d2i5wa1, d2i5wa2, d2i5wa3
  • Chain 'E':
    Compound: 5'-d(*gp*gp*tp*ap*gp*ap*cp*cp*tp*gp*gp*a)-3'
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: 5'-d(p*cp*cp*ap*gp*(g42)p*tp*cp*tp*ap*c)-3'
    Species: synthetic, synthetic
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i5wA (A:)
    sefghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
    teeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfq
    gvrllrqdpieclfsficsscnniaritgmverlcqafgprliqlddvtyhgfpslqala
    gpeveahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgt
    kvadciclmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwg
    pyagwaqavlfsadl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i5wA (A:)
    sefghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
    teeqlhctvyrqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvrl
    lrqdpieclfsficsscnniaritgmverlcqafgprliqlddvtyhgfpslqalagpev
    eahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvad
    ciclmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyag
    waqavlfsadl
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.