PDB entry 2i5s

View 2i5s on RCSB PDB site
Description: Crystal structure of onconase with bound nucleic acid
Class: hydrolase/DNA
Keywords: Onconase, P-30 protein, ribonuclease, anti-tumor, Structural Genomics, PSI-2, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG, HYDROLASE/DNA COMPLEX
Deposited on 2006-08-25, released 2006-09-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.181
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-d(*a*(du)p*gp*a)-3'
  • Chain 'X':
    Compound: P-30 protein
    Species: Rana pipiens [TaxId:8404]
    Gene: RNP30_RANPI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22069 (0-103)
      • modified residue (0)
    Domains in SCOPe 2.03: d2i5sx_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2i5sX (X:)
edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc