PDB entry 2i5l

View 2i5l on RCSB PDB site
Description: Crystal structure of Bacillus subtilis Cold Shock Protein variant Bs-CspB M1R/E3K/K65I
Class: gene regulation
Keywords: oligonucleotide/oligosaccharide binding fold, cold shock domain, beta-barrel, DNA binding protein, expression regulator, GENE REGULATION
Deposited on 2006-08-25, released 2007-05-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.227
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Cold shock protein cspB
    Species: Bacillus subtilis [TaxId:1423]
    Gene: cspB, cspA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32081 (0-66)
      • engineered (0)
      • engineered (2)
      • engineered (64)
    Domains in SCOPe 2.04: d2i5lx_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2i5lX (X:)
    rlkgkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
    anvtiea