PDB entry 2i5l

View 2i5l on RCSB PDB site
Description: Crystal structure of Bacillus subtilis Cold Shock Protein variant Bs-CspB M1R/E3K/K65I
Class: gene regulation
Keywords: oligonucleotide/oligosaccharide binding fold, cold shock domain, beta-barrel, DNA binding protein, expression regulator, GENE REGULATION
Deposited on 2006-08-25, released 2007-05-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.227
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: Cold shock protein cspB
  Species: Bacillus subtilis [TaxId:1423]
  Gene: cspB, cspA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32081 (0-66)
    • engineered (0)
    • engineered (2)
    • engineered (64)
  Domains in SCOPe 2.01: d2i5lx_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2i5lX (X:)
  rlkgkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
  anvtiea