PDB entry 2i5f

View 2i5f on RCSB PDB site
Description: Crystal structure of the C-terminal PH domain of pleckstrin in complex with D-myo-Ins(1,2,3,5,6)P5
Class: lipid binding protein
Keywords: PH domain, protein-inositol phosphate complex, LIPID BINDING PROTEIN
Deposited on 2006-08-24, released 2007-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.179
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pleckstrin
    Species: Homo sapiens [TaxId:9606]
    Gene: PLEK, P47
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08567 (5-108)
      • cloning artifact (2-4)
    Domains in SCOPe 2.06: d2i5fa2, d2i5fa3
  • Heterogens: 5IP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2i5fA (A:)
gsftgviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvt
svesnsngrkseeenlfeiitadevhyflqaatpkertewikaiqmasr

    Sequence, based on observed residues (ATOM records): (download) 
    >2i5fA (A:)
ftgviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsv
eseenlfeiitadevhyflqaatpkertewikaiqmasr